SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G18090.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G18090.1
Domain Number 1 Region: 209-299
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.9e-19
Family B3 DNA binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 14-116
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-18
Family B3 DNA binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT5G18090.1
Sequence length 301
Sequence
MKNKAFGQIMDDAENPGFFKILRSADLSSEIMRGIPLNFIKSISEEELSAKMLLKVSWGS
SWPIKICRNPSFYFMEKKGWDQFLSDNGLGNDEFLTFTHQGNMCFTVDIYQIDGKELLTP
RRSATIASSSGRNKREQRNNIYKDVKEEEDIESWSESSYPGHKTAESTGRRQRLSLSNKK
AKETEKSKKKKMKVESISYDSQDDSLSLVPEFTLTIKKSYLIFLGIPKMFEELHMPTEAT
MFKIHDPEGKRSWDVMYKFSNNQTRFCAGWIRLAKELGLEIGDVCTFTLIKPTEMLVRVS
K
Download sequence
Identical sequences A0A178UPJ1 Q9FK61
AT5G18090.1 NP_197310.1.80155 AR1853 GO.23158 AT5G18090.1 3702.AT5G18090.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]