SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G25470.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G25470.1
Domain Number 1 Region: 14-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.24e-16
Family B3 DNA binding domain 0.0069
Further Details:      
 
Domain Number 2 Region: 177-268
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000294
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT5G25470.1
Sequence length 280
Sequence
MLPRNATDKIQGNVSKPCFWKSLSPGQNWKSKSMRSFPEEFVKSTPGAFEHRVVFSVRWG
NSWQLWLEREEKDLFMIEEDWDEFVDDNHLGPNDNVFFRHDDKMFLEVQIFKNDGNEIID
APPEVEPETEPFHPTTPKNSHKETTTASASASASEFSDNWRETHGCADIKNPELYLLNPK
NPYFVKTLTKGNDVLYVPKTVIKKYGLKFGPHLSPMHYLLPGDKINGSTKIYGGGSAPCF
NGWVDLCRKYNLKTGDSMVCELERSGELVTAVRVHFINKT
Download sequence
Identical sequences Q1PDT6
3702.AT5G25470.2-P NP_001318648.1.80155 NP_568472.1.80155 NP_851074.1.80155 AT5G25470.1 AT5G25470.2 AT5G25470.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]