SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G25475.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G25475.1
Domain Number 1 Region: 13-115
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000275
Family B3 DNA binding domain 0.0063
Further Details:      
 
Domain Number 2 Region: 180-268
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000129
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G25475.1
Sequence length 282
Sequence
MLPKNAIEKIQANVSKPCFWKSLSPGQTWKSKSMRIIPEDFVRRTRGAFEHRVVFSVRWE
NSWQLWLEREKNELFMIEEDWNEFVDDNHLGPNDNLFIKHDETMNLEVQIFKNNGVEIID
VPLGVEPETEPFHPTPKKPHKETTPASSFASGSGCSANGGTNGRGKQRSSDVKNPERYLL
NPENPYFVQAVTKRNDVLYVSRPVVQSYRLKFGPVKSTITYLLPGEKKEEGENRIYNGKP
CFSGWSVLCRRHNLNIGDSVVCELERSGGVVTAVRVHFVKKD
Download sequence
Identical sequences Q680D9
AT5G25475.1 AT5G25475.2 AT5G25475.3 NP_001078620.1.80155 NP_568473.1.80155 NP_851075.1.80155 3702.AT5G25475.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]