SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G25475.4 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G25475.4
Domain Number 1 Region: 76-157
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000235
Family B3 DNA binding domain 0.0063
Further Details:      
 
Domain Number 2 Region: 222-310
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000173
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT5G25475.4
Sequence length 324
Sequence
MLPKNAIEKIQANVSKPCFWKSLSPGQTWKSKSMLPLWVLLRRRFRLPLAHKVITFSLMF
PLLNVSIVLLISGFIKRIIPEDFVRRTRGAFEHRVVFSVRWENSWQLWLEREKNELFMIE
EDWNEFVDDNHLGPNDNLFIKHDETMNLEVQIFKNNGVEIIDVPLGVEPETEPFHPTPKK
PHKETTPASSFASGSGCSANGGTNGRGKQRSSDVKNPERYLLNPENPYFVQAVTKRNDVL
YVSRPVVQSYRLKFGPVKSTITYLLPGEKKEEGENRIYNGKPCFSGWSVLCRRHNLNIGD
SVVCELERSGGVVTAVRVHFVKKD
Download sequence
Identical sequences F4JWT6
AT5G25475.4 AT5G25475.4 NP_001190395.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]