SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G28380.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AT5G28380.1
Domain Number - Region: 4-31
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00122
Family PHD domain 0.016
Further Details:      
 
Domain Number - Region: 144-183,224-375
Classification Level Classification E-value
Superfamily TPR-like 0.00841
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 
Domain Number - Region: 88-131,189-275
Classification Level Classification E-value
Superfamily TPR-like 0.0123
Family Tetratricopeptide repeat (TPR) 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT5G28380.1
Sequence length 390
Sequence
MGRVHAECDNITNERFKHNNYYCPDCKIQHELAPTILEEQNSVFNASVVHVGQGSSHQVN
GKGIQAAEPKSGSLVLIKGPTKQSFVGYDEAISLFDYFFNESQTLPNMLSCNLIIKAHCD
QGSVDHALELYRHILLDGSLAPGIETYRILTKALVGAKRLDEACDVVRSMSRCDFAVYDI
LIRGFLDKGKFVRASQIFEELKGPNSKLPWRNYHKAIAIFNVSFMDYWFKQGKDEEAMEI
FATLEHAELLNTISGNGVLKCLVEHGRKTEAWELFLDMIEICDSETVGIIMSKEGFFGEK
TIPFERVRRTCYTRMIASLCQQGNMLEAEKLFADMFADVDGDDLLAGPDVSTFRAMINGY
VKVGRVDDAIKTLNKMKISNLRKLSIHQAT
Download sequence
Identical sequences Q3E8X7
NP_198190.2.80155 AT5G28380.1 AT5G28380.1 AR2869 3702.AT5G28380.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]