SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT5G57720.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT5G57720.1
Domain Number 1 Region: 9-104
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.47e-20
Family B3 DNA binding domain 0.00035
Further Details:      
 
Domain Number 2 Region: 204-286
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000145
Family B3 DNA binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT5G57720.1
Sequence length 300
Sequence
MVLENGFPPYPDFLKIFNSHEDSQLLVIPRSYNRYYPNPLPQTAVLKNPEGRFWNVQWTK
SQEVIISLQEGWVKFVKDNGLIDRDFLLFTYDGSRSFWVRIHRNGLPLEPTAPIKIQEIS
DDEDETNGDGDPHMEEEGDTDENMIVSLSLGSSDEVGDDDDDDYDTAICDEVNKASGSSK
KGRVTRKHRDDSLASITPQIFLADPNNPFFISTSSCSRRILVIARQVIKDYGLNFDGTVN
LIDGFGELTRKVGKWKDRVVIYKWNEMFTRNKVKQGDVIICEIIREEDVVRSIKVHFVKN
Download sequence
Identical sequences A0A178UQC3 Q9FHH1
AR2179 3702.AT5G57720.1-P NP_200580.1.80155 AT5G57720.1 AT5G57720.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]