SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294155303|ref|YP_003559687.1| from Mycoplasma crocodyli MP145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294155303|ref|YP_003559687.1|
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00000000000536
Family Pseudouridine synthase RsuA N-terminal domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294155303|ref|YP_003559687.1|
Sequence length 76
Comment hypothetical protein MCRO_0003 [Mycoplasma crocodyli MP145]
Sequence
MVIKIKGEFIKVGQFLKKINEVSTGGRTKEFLKYNTIQINGKTPEGRSSKIRPGDIVWVN
DTLIKIEENKEEIKDN
Download sequence
Identical sequences D5E4J4
WP_013054302.1.77063 gi|294155303|ref|YP_003559687.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]