SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294155661|ref|YP_003560045.1| from Mycoplasma crocodyli MP145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294155661|ref|YP_003560045.1|
Domain Number 1 Region: 147-485
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.84e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00024
Further Details:      
 
Domain Number 2 Region: 493-607
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.19e-37
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000657
Further Details:      
 
Domain Number 3 Region: 2-92
Classification Level Classification E-value
Superfamily Single hybrid motif 1.3e-24
Family Biotinyl/lipoyl-carrier proteins and domains 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294155661|ref|YP_003560045.1|
Sequence length 617
Comment dihydrolipoyl dehydrogenase [Mycoplasma crocodyli MP145]
Sequence
MYKFKFADIGEGLHEGLVAEIFFKEGDKVNEGDSLFSVETDKVTSDIPSPVSGIIKSILM
KQGDTIHVGQEIFVIDDGKDHPAEPETSKATSSEQGASVVGEMKVNNDLIDFSSLNNKAT
PATSTTTTKVKESEYQGETGKAYTGAIKEEFDVIVVGSGPGGYLAAEEAGKSGLKTLIVE
KWAWGGVCLNIGCIPTKALLKSTEAIHELAHADKYGVIANLKDIKIDQTATWKAIHKRKE
DVVNKVAGSVKMLMTSSKCKILESEAKFVGAREIEVDGQVYRAKNLIIATGSRAKKLNMI
EGFDEGYKSGYVITSKEAINYKTKLPKSLVIIGGGVIGVEFAQIFALSGTKVTILQNSDR
ILPMADVDVSKEATKALKEMGVEIIFNAQTKQLNAKKELVYVLDGKEVKIKPELILTATG
RGPVSEGLSEVGIKLGKNQEVLVDNHQRTNVKGVYAIGDVTGQNMLAHVAYAHALAAVFD
ILGDTQKSTYHPKGVPGCIYINPEIAFIGKTEVEAKAEGKNVFASKYLFDYLGKAIATTH
TQGFVKLVVDKEYGEILGASIVGANATDYIAEIALAMEQEVTVHELAHTIHPHPTYNEII
WEAARSASLKLSLEKRK
Download sequence
Identical sequences D5E5K2
WP_013054306.1.77063 gi|294155661|ref|YP_003560045.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]