SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294155732|ref|YP_003560116.1| from Mycoplasma crocodyli MP145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294155732|ref|YP_003560116.1|
Domain Number 1 Region: 4-156
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 5.49e-47
Family Obg GTP-binding protein N-terminal domain 0.0000131
Further Details:      
 
Domain Number 2 Region: 160-330
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.41e-46
Family G proteins 0.0000202
Further Details:      
 
Domain Number 3 Region: 346-418
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 1.12e-18
Family Obg GTP-binding protein C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294155732|ref|YP_003560116.1|
Sequence length 420
Comment putative rRNA maturation-associated GTP-binding protein [Mycoplasma crocodyli MP145]
Sequence
MARFIDQINILVQAGKGGDGMISFRREAHVDKGGPDGGDGGNGGNIYFVGDLGKNTLLSF
YKNKHIIAEDGVKGGSKNLYGANAFHTYIKVPIGTLVYKNNKLICDVIEPDVPYLVAKGG
KGGRGNTKFKTSKNTAPRICENGLPGEKYEAKIVLKILSDVGVVGKPSAGKSTFLNAISN
ANAKVAEYEFTTLVPQLGMVKYFENSFSVADLPGLIKGAALGKGLGIQFLKHIERCRVIA
HIIDFGSETKDPIKDYEVINNELKSYDLKLEEKEQLVIANKSDLESFKNNVKRFKKKYPN
IQLVEISAINRSNMDNVKKVLWEMVQKITIKPIEQEEKELLITYEPDFKVFSPYKGHFEI
SGKKIEELYHKIPINSYDNLLRFNNILKKIGVWDELIKMDIKPGNTVSIFEYQFEWENEN
Download sequence
Identical sequences D5E5S3
WP_013054644.1.77063 gi|294155732|ref|YP_003560116.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]