SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294155799|ref|YP_003560183.1| from Mycoplasma crocodyli MP145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294155799|ref|YP_003560183.1|
Domain Number 1 Region: 2-198
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 1.26e-57
Family Ribosomal protein S4 0.0000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294155799|ref|YP_003560183.1|
Sequence length 199
Comment 30S ribosomal protein S4 [Mycoplasma crocodyli MP145]
Sequence
MARYTGPVFKKSRRLGFSILETGKEFAKGKKRTYAPGQHGNKRVKLSDYGLHLYEKQKIK
YVFGISEKQLQKSYIKATKIKGITGTNLLQVLESRLDNLVYRAGFAQTRRQARQLVNHNH
FLVDGKKADIPSMSIKIGSTITLKEKSQKNIQITDALANKAASPWLTRKDFNFKFDRLPE
RNEMHSEIKDALIVEYYAK
Download sequence
Identical sequences D5E5Z0
gi|294155799|ref|YP_003560183.1| WP_013054159.1.77063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]