SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294155816|ref|YP_003560200.1| from Mycoplasma crocodyli MP145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294155816|ref|YP_003560200.1|
Domain Number 1 Region: 2-309
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 2.35e-85
Family Tex N-terminal region-like 0.0000413
Further Details:      
 
Domain Number 2 Region: 311-457
Classification Level Classification E-value
Superfamily Ribonuclease H-like 2.53e-39
Family Tex RuvX-like domain-like 0.00008
Further Details:      
 
Domain Number 3 Region: 458-544
Classification Level Classification E-value
Superfamily RuvA domain 2-like 5.34e-23
Family Tex HhH-containing domain-like 0.0013
Further Details:      
 
Domain Number 4 Region: 548-616
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000000000289
Family Tex HhH-containing domain-like 0.022
Further Details:      
 
Domain Number 5 Region: 627-694
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000002
Family Cold shock DNA-binding domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294155816|ref|YP_003560200.1|
Sequence length 700
Comment RNA (S1 domain)-binding protein [Mycoplasma crocodyli MP145]
Sequence
MIKALQFVAFELNIKESQIQKTLKLLEEGNTVPFISRYRKDVTEGLDEEVIHQIDVMYSY
YVELIKRQDAIIEILKERKLLTEELEKQIKSTTKKADLEAIYEPFKLGKKTKATDAIALG
LEELAKEIFNNKDEKFNPYKFAEKFITEKVPTIDFAIENALYIISQWISQDVEVRNYIRE
QYLNFGKIETKLKQPDLDENQNFKIYYDFKGTVSRIQNYQVLAINRASDLKIVTYKILIN
DKVVRYHLTNKFFKNKRTATLINRAIDDSLERLIKPSLEREIFAYLFDKAEQKAIELFAE
NLESMLMTPAVKDKVVLAIDPAYINGCKTAVLDKNGNVLNIDIIYPNGKFAKPEEATKTI
LKIVKAYDIDIIVIGNGTASQETTRFIKALLNHFKLDIQVEIVSEIGASVYSASDVAIKE
FPKLSVEQRSAINIGRKFQDPLNEIVKIEPKSIGIGQYQHDLNQKELGTALDFKVDKVVN
LVGVNLNTATKEILTHISGLTSKIADSILEYRKTVKEFSNRLELKEVKGLGPKSFEQCVG
FLRIFNSNNFLDRTNIHPENYSLANKIIKEYDYDFNTNKFNKEVNADKILQESKTDKYSL
ELILDSLNNPTKDIRDNKKGFKINLDLNDIDDIVVDEIYDGRIENITDFGAFVFIGIKTN
VFIHFSKYKNKPIALGSDIKVKVISIEKDRKRISGEFVDI
Download sequence
Identical sequences D5E607
gi|294155816|ref|YP_003560200.1| WP_013054452.1.77063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]