SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294155840|ref|YP_003560224.1| from Mycoplasma crocodyli MP145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294155840|ref|YP_003560224.1|
Domain Number 1 Region: 58-224
Classification Level Classification E-value
Superfamily Pseudouridine synthase 1.38e-37
Family Pseudouridine synthase RsuA/RluD 0.0000345
Further Details:      
 
Domain Number 2 Region: 1-47
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.000000236
Family Pseudouridine synthase RsuA N-terminal domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294155840|ref|YP_003560224.1|
Sequence length 228
Comment ribosomal small subunit pseudouridine synthase A [Mycoplasma crocodyli MP145]
Sequence
MRIEKWLSDVTDYTRSEIKNLLKNNRVYINGRLYDETIKYNEFNSLRIDGIDYATDKYVY
IMLNKPQGYITSNKDELYPSVFNLIDVPRKNLIAYGRLDVDTEGLLVLSDNHKLCHELLA
PKKHVFKKYLVQVDKQLEPNLIDIFKQGFSIGEDKNTLPSKLEIIDNFTCYLTISEGKFH
QVKRMFKTNGYNVIFLKRVSFKNIILDEKLKPSQWRFLSSDEINDLIN
Download sequence
Identical sequences D5E631
WP_013054479.1.77063 gi|294155840|ref|YP_003560224.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]