SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294155853|ref|YP_003560237.1| from Mycoplasma crocodyli MP145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294155853|ref|YP_003560237.1|
Domain Number 1 Region: 11-85,177-353
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.77e-50
Family Bacterial dinuclear zinc exopeptidases 0.0000817
Further Details:      
 
Domain Number 2 Region: 75-185
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.98e-24
Family Aminopeptidase/glucanase lid domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294155853|ref|YP_003560237.1|
Sequence length 362
Comment aminopeptidase [Mycoplasma crocodyli MP145]
Sequence
MDKKYEKLAKSLDTFMNIEAMSRYEEVIVQEILKQVDTKNFIISRDNLGSLILHKPSKIK
GAPKVMYAAHMDEVGYLVRNISKEGMLMVSPVGGVWASTVIGTKAKVVTNKTNKEFIGVF
GHTSVHIMERDKLTKAMSNDELYVDLGFLSEKEAQDAGIEMGDRVYMSGQTIHFPNNIIA
GKAMDNRAGVTSIVAIANNIANIDLDVDLYIVGTVQEEVGCRGAKTSIMLIDPQIAFAID
TGASHDTPNCITGVPKLGNGVAVLVKDSGTLMDPLLVENVMEVARQNNIPAYKYIAEGGG
TDAANLQFGKGGVATLTLSIPQRYLHSPIGSCSLIDIQAVVDLGTEFAKSMNTSKYKKMQ
YK
Download sequence
Identical sequences D5E644
WP_013054785.1.77063 gi|294155853|ref|YP_003560237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]