SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294155876|ref|YP_003560260.1| from Mycoplasma crocodyli MP145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294155876|ref|YP_003560260.1|
Domain Number 1 Region: 3-201
Classification Level Classification E-value
Superfamily RmlC-like cupins 1.09e-43
Family Type I phosphomannose isomerase 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294155876|ref|YP_003560260.1|
Sequence length 251
Comment mannose-6-phosphate isomerase [Mycoplasma crocodyli MP145]
Sequence
MKKVIPVKHEKIWGYEIWLYSPLKEAPTQYEDKSGYVSRGPLIKIIKANDPLSIQVHPDN
ELAKELENQDNGKSESWLVLDCNEKSELVVGLNNHDQKVIEQALQNKTIDKYLKVIKPKI
GQFIDIPAGLVHGIGRPNASGITVLEVQQPSDVTYRFWDYNRKDKNGNFRDLHVNKALKS
IKDLNYKVKPSIENETLIYKTEYYKLHLLSDVKVAPSDGVAIINSNDEYFAEEILKDEKL
NKDTVFFVEEI
Download sequence
Identical sequences D5E667
WP_013054152.1.77063 gi|294155876|ref|YP_003560260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]