SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294155981|ref|YP_003560365.1| from Mycoplasma crocodyli MP145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294155981|ref|YP_003560365.1|
Domain Number 1 Region: 2-286
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.16e-36
Family FAD-linked reductases, N-terminal domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294155981|ref|YP_003560365.1|
Sequence length 381
Comment glycerol-3-phosphate dehydrogenase [Mycoplasma crocodyli MP145]
Sequence
MKKYDVAIIGGGIIGASVAYELSKYDVKTVILEKNPVLGSETSLANTGLIHGGFDPEPHK
IEAWMNVKGNRKWVNTWFKHLTFPRVKVDSLICAFNEEEMKHIHMLYDRGLINKVKAEDM
QILNSQEIQKREPNLSKEIIGGLLCTSSWAIAPVEATKALVGASLKNNLTLMKNSTVTKI
EKNREGFFEISIEGQEKILARKVVDAAGHYADVIANENNFDDFKQTTKRGEYRVLTKYIN
NLVNSVVFMVPTIHGKGVVVAPTLDGHYIVGPTAEDGVPKEETRLVTREKYDYIGKIGKK
LIPNLDVDKTMMTLAGSRPIDVETNDFVIRKSKNDKDFILAAGMQSPALSSAPIIAEEVV
KLLEMNLKKNENWDPKFEVIS
Download sequence
Identical sequences D5E6H2
WP_013054559.1.77063 gi|294155981|ref|YP_003560365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]