SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294155536|ref|YP_003559920.1| from Mycoplasma crocodyli MP145

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294155536|ref|YP_003559920.1|
Domain Number 1 Region: 491-562
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 3.53e-16
Family Glucose permease domain IIB 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294155536|ref|YP_003559920.1|
Sequence length 569
Comment PTS system, N-acetylglucosamine-specific, IICBA component [Mycoplasma crocodyli MP145]
Sequence
MNTATTQTSSFNHYFRKAMEKLGRVGKALMFPIAVLPIAAILLRIEADIPNDTAFSAAIG
FMIVNAGGIVFDNLPILFAIGLAFGFTKDSRGEAAFAGFIAMVLLTALLSNKGLPHLIYK
NLDLGAKEADGKNAEGIMQYTYGFKALFGSKYNAVMASNVLNGIVVGSLTAFIYNRIHSV
DMPKLLAFFAGRRLVPAYTILAVMIFGVLWAIVFPWIAYLIYLISDALYKGASSGFVARA
GIMGAYGFINRLLIPFGLHHIPNNLFWFQLGEFPTGKFDDKGVALLAHGDIFVFLNGVAK
NNPGGIFQAGFFPTMMFGLPAMVGAFYLTAQGKEQKTRVLAMYGSAALVSFLSGITEPIE
FAFMFVSPLLYFIHALLTGIFAFITGLFGIQIGFGFSAGFMDYVLSFPKSQAIIRESDVF
INSPLRAVFANPLWILPIGAVCAGVYFTITFFMIKGLNLNTPGRGTNLIELAEDNADDVQ
LSSNSNMSTKAKLIVLGYGGWENIEEFANCSTRLRYIVKDGSKVNEALLKKAGAMGVVRL
SDKSIQTIVGVEAETINGEIVDNKGTELK
Download sequence
Identical sequences D5E577
gi|294155536|ref|YP_003559920.1| WP_013054318.1.77063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]