SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AAEL001523-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL001523-PA
Domain Number 1 Region: 4-126
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 2.36e-31
Family Insect phospholipase A2 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL001523-PA   Gene: AAEL001523   Transcript: AAEL001523-RA
Sequence length 131
Comment pep:novel supercontig:AaegL1:supercont1.35:1210708:1219352:1 gene:AAEL001523 transcript:AAEL001523-RA
Sequence
MLRVPGTKWCGKGWSARNYVEMGGLSKADRCCRQHDLSCPFWILGFETKYGVFNWRVNTL
MHCSCDERFRTCLKMSDSSDANMVGKLFFNIVQSKCFVLKPETVCTKTSWWGKCEKKIRK
KRALIRDNRKY
Download sequence
Identical sequences Q17L01
AAEL001523-PA 7159.AAEL001523-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]