SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AAEL002154-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL002154-PA
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 3.92e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00022
Further Details:      
 
Domain Number 2 Region: 52-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 3.4e-17
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL002154-PA   Gene: AAEL002154   Transcript: AAEL002154-RA
Sequence length 107
Comment pep:novel supercontig:AaegL1:supercont1.50:2291057:2294803:1 gene:AAEL002154 transcript:AAEL002154-RA
Sequence
MSYQLYRNTTLGNTLQETLDELIQYGQITPALAVRVLVQFDKSINSALSNRVKSRVTFKA
AKLNTYRFCDNVWTLMLNDVEFREVHEFAKVDKVKIVACDGKIESIS
Download sequence
Identical sequences Q17J11
AAEL002154-PA 7159.AAEL002154-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]