SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AAEL006826-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL006826-PA
Domain Number 1 Region: 129-259
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.97e-34
Family Insect phospholipase A2 0.0000442
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL006826-PA   Gene: AAEL006826   Transcript: AAEL006826-RA
Sequence length 260
Comment pep:novel supercontig:AaegL1:supercont1.222:568015:583711:1 gene:AAEL006826 transcript:AAEL006826-RA
Sequence
MVQIEDYDDEGNSQSYFLHSSPYSESFFRDVLQRLGVYKYILDYQADGQSEKPNQLGPKV
PHRFHPHFINTPKGIRNLPNHFVDQVSPSLTSTTPVGIGASSSTKRPPKPHKTHGGGLFN
QFKQRIKAIYPGTVWCGDGNQAKSENDIGFFYMTDACCRAHDLCPAAIAAGEQFNRLKNN
GYFTRSHCDCDKQFYNCLKNANTLVSNQIGYTYFNLLKPQCFRHEHPKVACSKKIKGKCI
TYVVDENQDKVWQWFDNLIY
Download sequence
Identical sequences Q174Q2
AAEL006826-PA 7159.AAEL006826-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]