SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AAEL007851-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  AAEL007851-PA
Domain Number - Region: 208-250
Classification Level Classification E-value
Superfamily Plus3-like 0.0523
Family Plus3 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL007851-PA   Gene: AAEL007851   Transcript: AAEL007851-RA
Sequence length 293
Comment pep:novel supercontig:AaegL1:supercont1.286:881226:891498:-1 gene:AAEL007851 transcript:AAEL007851-RA
Sequence
MYRNSNQRIDVDETGSRSAPNPSGFPGKPRGGLLVCSEKSKQMLESIVNNQAKMMDNQQK
MMQMIIDTIANVQYLSENVKSASRASSGSAGTSRSSTVPVSFTADIMNPVNSVDELNALE
TLLSDDTVMQQYVGKLSFICGNSGRANGIDCCYKLIDHLVTRPFLVQCSWTGNSRTTAPT
DNGSQELFPDMENGKVALKFYKKFRALFLNLIILADSSFTDMECETFFKRIMKNSKQRVL
CKMISSKHRNRPRNLKYNIQRPGTSSQAPSMDVADNSASEFVDVNSGLFDPPN
Download sequence
Identical sequences Q170N4
7159.AAEL007851-PA AAEL007851-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]