SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AAEL014058-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL014058-PA
Domain Number 1 Region: 4-225
Classification Level Classification E-value
Superfamily CutC-like 1.15e-50
Family CutC-like 0.0000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL014058-PA   Gene: AAEL014058   Transcript: AAEL014058-RA
Sequence length 259
Comment pep:novel supercontig:AaegL1:supercont1.998:63917:71469:1 gene:AAEL014058 transcript:AAEL014058-RA
Sequence
MCPLLEICIDSFESAVAAIRGGADRLELCAALSEGGLTPSVGLLRETRNFIQENNQFQPV
QLYAMIRCRRGSDFCYSPAEMRIMLHDLELLAENGADGFVFGALDEAGNVHRENCGMVVA
EALKHRKAITFHRAFDCTDRTEMLANVELVGSLGFTTLLSSGLESTAMKGIGNLVEMVKF
VAERDDIQLTIMPGSGVSPNYAQEIVQKTGCKAIHASARSLKKDSKGSSIAMGGNAADGE
GLLVCNETIVRDIKSQITS
Download sequence
Identical sequences Q16HD7
XP_001664302.1.48696 AAEL014058-PA 7159.AAEL014058-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]