SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AAEL008243-PA from Aedes aegypti 55

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AAEL008243-PA
Domain Number 1 Region: 6-340
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.31e-58
Family ADP-ribosylglycohydrolase 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AAEL008243-PA   Gene: AAEL008243   Transcript: AAEL008243-RA
Sequence length 345
Comment pep:novel supercontig:AaegL1:supercont1.309:43249:69378:1 gene:AAEL008243 transcript:AAEL008243-RA
Sequence
MEKILLRSKFRGSLLGTLVGDCCGAPFEGQLMDSGSKLVLRQNLDKLEGPFFKAPYKKYT
DDTALTKCVLSTLLSPNGFSQKLLAKNFVLEYFKDPRRGYGAAVGDVFDKLRKTKIADPV
GPAAAQFGGSGSFGNGAAMRVAPIALYCVNRDNTHLLQMVRDASLVTHSHTLGINGAILQ
ALAITQSLKLNPEEQLNAKQFLAKLKTDIVEVEKENDPDLDANYNAYQKQLDAVEQLLDG
KIETSDENVLNLLGHSVAALHSVPTAIFCFLKCTDGTASHRSFRDTLEYAISLGGDADTI
ASMACAISGAFLGAEAIAENLVKHCEDAENIASMADQLLEAVVKG
Download sequence
Identical sequences Q16ZC1
XP_001653130.1.48696 XP_021709981.1.48696 7159.AAEL008243-PA AAEL008243-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]