SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85057305|ref|YP_456221.1| from Aster yellows witches'-broom phytoplasma AYWB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85057305|ref|YP_456221.1|
Domain Number 1 Region: 313-834
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 4.27e-149
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000000498
Further Details:      
 
Domain Number 2 Region: 168-312
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 2.88e-38
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000633
Further Details:      
 
Domain Number 3 Region: 11-125
Classification Level Classification E-value
Superfamily Flavoproteins 0.00000000000879
Family Flavoprotein NrdI 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|85057305|ref|YP_456221.1|
Sequence length 845
Comment ribonucleoside-diphosphate reductase alpha chain [Aster yellows witches'-broom phytoplasma AYWB]
Sequence
MPALFPKKIKVIYDGLLQGQVYEMAQSLGFSFQHIQDVPSKLTDENVFLLTRSVKFGQVS
DDAKTFLEKNATKVIGVAVSGNKNWGKNYGKAGDTIASNYNVPLVLKFEGSGMPEERVFL
KKWLACYCNNQKLPSYQFKTQPQMPTSKKTVLPPWIILNNQIIDEQGKIKDLNKDKEALQ
SFLQEGVAPKLKRFATLQDKLTFLQENEYYESTFLQKYNYSQIKEIYQIAYQKNLTFPTF
MGAFKFYHDYALKTRDKQHYLETYEDRLSINALYHAKGDFAIAKRLIVSLINQDFTPATP
TLLNTGKKHRGEFVSCFLLEAGDSLNDIARINEFSMQLSKIGGGVSINITNLRAKGESIK
GIKGVCKGVVGVCKLLDHSFRYADQMGQRTGAGAVYLNVFHADIIDFLSTKKLSADEDVR
VKTLSLGVVVPNKMIELARKNEVMYTFFPHTVFLEYGKNFADIAVDMSYWYDILIVNPKV
QKKAINPRQLLELIAQMQGESGYPYLMFCDNTNQANTSDLKVKFSNLCTEILQPTITSHY
KDYHQTQQDEIGMDVSCNLASGHMGNMITNNTIQETVFMAMEVMNCVSENTNISYVPAVA
KANFLNRSVGFGIMGHHGFLAQNYIAFGSEENKDLIDVFFNAINFYSLLHSCNKAKTTGK
KFYRFKKSKYADGSYFNNRGEILPKTNKIKKMFQNITLPTQSDWNQLKQDVMKFGLYNSH
RLAIAPNGSIGYIMGATPSLTPVKQLVEERTYGNSKTYCPMPALKQASFMYTTAYKINKY
DLIDVIAIAQKHVDQGISFELGITSDITTRELQKYYLYAHHKKIKTLYYTRTQKLKIDEC
EACGV
Download sequence
Identical sequences Q2NKA1
gi|85057305|ref|YP_456221.1| 322098.AYWB_025 WP_011412309.1.27578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]