SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85057602|ref|YP_456518.1| from Aster yellows witches'-broom phytoplasma AYWB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85057602|ref|YP_456518.1|
Domain Number 1 Region: 116-203
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000623
Family Intein endonuclease 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|85057602|ref|YP_456518.1|
Sequence length 339
Comment hypothetical protein AYWB_322 [Aster yellows witches'-broom phytoplasma AYWB]
Sequence
MSFNIKIKEEIACQKFLHIENFFELTALLHFGCELEKNHQKTLLWFQTKSIKIARRFLIL
IKTFYPDTNSFLMTSKEYNLPHLKSIHVGIEKDIPLILEKHHFFTQNSSVFLPLIKSQKS
KKAFLRGIFLCIGFVNDPKKTNYHLEFFHKDSNKIELIKTLMLHFGLNAKQINHKKGFLV
YLKESQMIIDFLRLIGALEMVFQYEKTIIQKDLNHIIKSSINFEISNEKKILTSANLQLK
QINLIEKYFQTPNLKPKNTNIKNLKSKKQLPNLEPKLLQIMLLRKKNHDASLQELTQKYY
HKHKQQITKSGLNYYFQKIKKIACEIETAQTLAPYKEKK
Download sequence
Identical sequences Q2NJF4
gi|85057602|ref|YP_456518.1| WP_011412603.1.27578 322098.AYWB_322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]