SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85057784|ref|YP_456700.1| from Aster yellows witches'-broom phytoplasma AYWB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85057784|ref|YP_456700.1|
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily Ribosomal protein L30p/L7e 7.85e-18
Family Ribosomal protein L30p/L7e 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|85057784|ref|YP_456700.1|
Sequence length 65
Comment 50S ribosomal protein L30 [Aster yellows witches'-broom phytoplasma AYWB]
Sequence
MKLKITLTKSLIACRFNQIKTAHCLGLKKINNQVIKDDTPAIHGMIKTISHLVVVEKVSY
TKEQK
Download sequence
Identical sequences Q2NIX2
322098.AYWB_504 WP_011412783.1.27578 gi|85057784|ref|YP_456700.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]