SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85057906|ref|YP_456822.1| from Aster yellows witches'-broom phytoplasma AYWB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85057906|ref|YP_456822.1|
Domain Number 1 Region: 152-333
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.62e-43
Family G proteins 0.00000784
Further Details:      
 
Domain Number 2 Region: 2-157
Classification Level Classification E-value
Superfamily Obg GTP-binding protein N-terminal domain 1.83e-43
Family Obg GTP-binding protein N-terminal domain 0.0000131
Further Details:      
 
Domain Number 3 Region: 349-418
Classification Level Classification E-value
Superfamily Obg GTP-binding protein C-terminal domain 3.4e-20
Family Obg GTP-binding protein C-terminal domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|85057906|ref|YP_456822.1|
Sequence length 419
Comment GTPase ObgE [Aster yellows witches'-broom phytoplasma AYWB]
Sequence
MHFVDEAFNEVFAGNGGHGIVAFRREKYVAFGGPAGGNGGNGGSVIFVGDKGENTLLKLK
YQKHLKAPHGINGKNKGQNGANAPHLYVKVPLGTVFYTADNKFLGEILYDQQTLVIAKGG
KGGKGNKALATFKNQAPSYSEKGDLGESFKIKTELKVLADIGLLGFPSVGKSSLISAISK
AQPKVASYPFTTIKPHLGVVEVDGFSFVVADLPGLIENAHLGCGMGIQFLKHIERCRVLV
HILSMESSNPYQDFQTLNQELKQYNPQLLLKKQIIVTNKMDLPDSLKKLTLLKQKIKGQP
IIPLSLVSFDNLEILKYKMSSFLQNTPLEVNPNNNNDFKLYTLTDNLKTISVIKESDSVF
VVSGNQVEIFFHRTDFNNEESVKRFNRILKKIGMEEQLQKKGAKPGDQVKICDRLFDFL
Download sequence
Identical sequences Q2NIK0
322098.AYWB_626 gi|85057906|ref|YP_456822.1| WP_011412905.1.27578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]