SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85057938|ref|YP_456854.1| from Aster yellows witches'-broom phytoplasma AYWB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85057938|ref|YP_456854.1|
Domain Number 1 Region: 8-82,173-353
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.73e-59
Family Bacterial dinuclear zinc exopeptidases 0.00000346
Further Details:      
 
Domain Number 2 Region: 72-181
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 7.63e-29
Family Aminopeptidase/glucanase lid domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|85057938|ref|YP_456854.1|
Sequence length 356
Comment endo-1,4-beta-glucanase [Aster yellows witches'-broom phytoplasma AYWB]
Sequence
MRMKMSDLVSLLKNLTMLNGIPGQEKAVANYVVNKIQNQVDSIQYDNLGSVIACKGKTGP
RIMFAAHLDEIGLIVKQITPEGFIKFQTLGGWFSQVMLAQVWQIHTDKGILKAVTGCKPP
HAMSFQDRNQVINTSSMYLDIGVANKEEALKLGVRVGDMVTPYIEFSTLGNSDYLLAKAL
DNRVGVAIVMQVLQNVNPTTHQFFGVFTTQEEVGLRGAQTSAHKVHPQIAIAVDTGIGND
VPGGEKEGHTLGKGPQVLVYDGGLVAHKGLRNFVLKIATENNIPVQEISGIGGRTDAATM
HLVREGAASLSFCVPVRYIHSHTSVVHKQDIINTIKLLTLLANQLDEKKINEILFQ
Download sequence
Identical sequences Q2NIG8
gi|85057938|ref|YP_456854.1| 322098.AYWB_658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]