SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|85057940|ref|YP_456856.1| from Aster yellows witches'-broom phytoplasma AYWB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85057940|ref|YP_456856.1|
Domain Number 1 Region: 4-117
Classification Level Classification E-value
Superfamily Ribosomal protein L20 7.46e-44
Family Ribosomal protein L20 0.0000389
Further Details:      
 
Domain Number 2 Region: 187-226
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000018
Family Rho termination factor, N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|85057940|ref|YP_456856.1|
Sequence length 227
Comment 50S ribosomal protein L20P [Aster yellows witches'-broom phytoplasma AYWB]
Sequence
MAKISFTPARHRRRKKVLKMAKGYFGSKSTLYKTAHEQVMRSLQYAYRDRKQRKRDFRKL
WISRINAGAMLCGMQYSRLMHGLALAKVDVNRKVLSDLAHLQPETFAQYVQLAKETLVQF
QQTFKKKENQSTKLQEVQSNQLAQTEEKTSLQLEKVLSNELSEEKSDYALETQPQITQIK
AKKPSLDLSKMLLPELKKLAKEHKVPNFNKLKKTEIVSALKKALAKK
Download sequence
Identical sequences Q2NIG6
WP_011412938.1.27578 322098.AYWB_660 gi|85057940|ref|YP_456856.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]