SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56476082|ref|YP_157671.1| from Aromatoleum aromaticum EbN1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56476082|ref|YP_157671.1|
Domain Number 1 Region: 644-809
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.19e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 2-193
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.23e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.003
Further Details:      
 
Domain Number 3 Region: 144-320
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.4e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0045
Further Details:      
 
Domain Number 4 Region: 533-636
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.74e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.031
Further Details:      
 
Weak hits

Sequence:  gi|56476082|ref|YP_157671.1|
Domain Number - Region: 468-516
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.0196
Family HMA, heavy metal-associated domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56476082|ref|YP_157671.1|
Sequence length 823
Comment assimilatory nitrite reductase, large subunit [Aromatoleum aromaticum EbN1]
Sequence
MKKMKLVMIGNGMAGVRTLEELLKHAPDLYDITVFGAEPHGNYNRILLSPVLAGEMTLPE
IMLNDLGWYRDNGITLHAGKRITKIDRVRRRVIAGDGTEAEYDRLLVATGSTPFIPPIPG
KELPGVLAYRDIADTEAMIDAAARYRHAVVIGAGLLGLEAANGLMLRGMDVTVVHLADWI
MERQLDRAAADMLQASLEAKGMKFLLAKQTDALVEGGGDKNNAGRVAGVRFKDGGEIPAD
LVVVAAGIRPNYALAESAGLHCGEGRVRGIVVSDTMQTITDPRIYAVGECVAHRGVAYGL
VAPLFEQGKVCANHLANFGIGRYEGSVTSTKLKVTGIDVFSAGDFSGGADTEEIVLHDRQ
GGVYKRIVLRNNRIVGSVLYGDTADGAWYFQLMKDGQDIGAIRDHLMFGQNNLGDAGHKG
ENKAAAMPDSAEVCGCNGVCKGTIVKAIKEKGLFTIDDVKKHTKAASSCGSCTGLVEQIL
ASTIGGAYQAVSVHDKAVCACTELSHGDVRKAIRDHKLLTIPAAMDMMAWKTPNGCATCR
PALNYYLISTWPHEAKDDPQSRFINERAHANIQKDGTYSVVPRMLGGLTTPAELRRIADV
AEKYQIPTVKVTGGQRIDLLGIRKDDLPKVWQDLGMPTGHAYGKSIRTVKTCVGSEHCRF
GTQRSMAMGVDLERMLFGMWSPHKVKLAVSGCPRNCAESGIKDVGVIGVDSGWELYVAGN
GGIKTEVAQFLCKVATREEVLEYSAAFLQLYREEGFYLERTVHYVHRVGLEHVKKRVVED
AVNRKALYERLLYAVQDYTDPWAERYAADAAQALRAQFETLEA
Download sequence
Identical sequences Q5P7E1
WP_011236498.1.4884 76114.ebA1216 gi|56476082|ref|YP_157671.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]