SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56476909|ref|YP_158498.1| from Aromatoleum aromaticum EbN1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56476909|ref|YP_158498.1|
Domain Number 1 Region: 120-286
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.96e-46
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00053
Further Details:      
 
Domain Number 2 Region: 408-547
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.93e-42
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00074
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.74e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.032
Further Details:      
 
Domain Number 4 Region: 252-276,315-421
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.43e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56476909|ref|YP_158498.1|
Sequence length 561
Comment sulfite reductase [Aromatoleum aromaticum EbN1]
Sequence
MYRYDDYDQQLLDERVVQFRDQMRRHLAGELSDDEFRPVRLQNGLYIQRHAPMYRISVPY
GHLASRQLRKLAYLARTYDRGYAHFTTRTNVQFNWSPLEAIPDMLAELASVQMHSNQTSG
NDIRNITADAFAGVAADEIVDPRPWAEILRQWATYNPEFAYLPRKFKIALNGATEDRVVV
RIYDIGLDLKRDADGNIGFRVLVGGGLGRTPILGEEIAGFVPWQHLVTYCESILRVYNRH
GRRDNVWKARIKILVKALGAEEFARQVEEEWAHVKDGPNTLTEAEVQRVAAHFVDPDYET
LPGRNALYEAQLADSKPFAAWVKRNVRAHKVPGYASVTLSLKKTGVPTGDITAEQMELVA
DWADRFSFGEARMTHEQNIVLADVKLSDLHTLWQLAREAGLATPNIGLLTDIICCPGGDF
CALANAKSIPIAEAIQQRFDDLDYLYDIGDIDINISGCMNACGQHHVGNIGILGVDKNGE
EWYQVTIGGCQGNATALGKVIGPSFARAQMADVVEKLIETYIEYRHEDERFVDTVHRLGI
EPFKQRVYGGEVQKQRKVAHA
Download sequence
Identical sequences Q5P515
WP_011237315.1.4884 gi|56476909|ref|YP_158498.1| 76114.ebA2619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]