SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56479084|ref|YP_160673.1| from Aromatoleum aromaticum EbN1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56479084|ref|YP_160673.1|
Domain Number 1 Region: 219-351
Classification Level Classification E-value
Superfamily Cell-division protein ZipA, C-terminal domain 6.54e-36
Family Cell-division protein ZipA, C-terminal domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56479084|ref|YP_160673.1|
Sequence length 369
Comment ZipA-like protein [Aromatoleum aromaticum EbN1]
Sequence
MDSELQIGLAALGITAVVGIIAYNKWQERKHRRQAEQAFKSEHRDVLLEPQEAPQGERVE
PWTTEFPSPDANPAPASIPHPAAHGPVGRVTPGLPPAIDPRIDCVIRIESIELLHAPRLW
TAQSEQLQGISKPVRWFAFDDAENLWRPLTAHSAGSFHWFCAAMQLVDRHGAIGENDFMH
FSGGVQRVAEQFLAVPTDLPTRAEALRNAADLDQFCAGVDVQIGVNIISHNQPFAGTKIR
ALAEASGMTIGDDGAFHARDESGHTLFTLCNMEPALFAADEMRNLMTNGLTFVIDVPRVA
NGVVVFDHMMQQANHMADALQGNVVDDNRAPFGPDAALLIRSQIQQFQAQMADSEVPAGS
PLALRLFSA
Download sequence
Identical sequences Q5NYU2
WP_011239425.1.4884 76114.ebA6382 gi|56479084|ref|YP_160673.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]