SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|56477136|ref|YP_158725.1| from Aromatoleum aromaticum EbN1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56477136|ref|YP_158725.1|
Domain Number 1 Region: 145-282
Classification Level Classification E-value
Superfamily NTF2-like 0.000000000745
Family SnoaL-like polyketide cyclase 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56477136|ref|YP_158725.1|
Sequence length 283
Comment hypothetical protein ebA3013 [Aromatoleum aromaticum EbN1]
Sequence
MKNLLLGLIAVIFTLGFGIPDADAKRLGGGGSFGMQRQMTPPTPRQPSAAPQQTPQGANA
VPQKRSWMGPLAGLAAGLGLAALFSHLGFGAEMGSLLMIALLVFAALMLFRMLSRRNAAA
RSGGAMQYAGAPAGGNFPASAPTSFPAASSAAAPAPAGKIPTNFDAEAFVRQAKVQFIRL
QAANDAGNLEDIREFTSPEMFAEIRMQLTERGPGTQRTDVVELNGEVLEVVEEAQRYVVS
IRFSGLLREEEGAAPAAFDEVWHLTKPSTGNVGWVVAGIQQLS
Download sequence
Identical sequences Q5P4D9
gi|56477136|ref|YP_158725.1| 76114.ebA3013 WP_011237538.1.4884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]