SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|58616437|ref|YP_195566.1| from Aromatoleum aromaticum EbN1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|58616437|ref|YP_195566.1|
Domain Number 1 Region: 118-259
Classification Level Classification E-value
Superfamily NTF2-like 3.15e-18
Family VirB8-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|58616437|ref|YP_195566.1|
Sequence length 261
Comment TrbF protein of DNA transfer system [Aromatoleum aromaticum EbN1]
Sequence
MSIADTMKGLIFKKKAELNGDPLDPRNAGATMVRGRREGEVENPYLAARRTWNDHVGSIV
SQRQTWQVIGILSLLIALAGVGGVIHIGSQSKFIPYVVEVDKLGQMVAAGPVTAAAKADP
RVVHASVAEFIGDARIVTPDVALQRKAVFRVYAKLSPNDPATAKMNEWLNGHPEASPFKR
AEKEMVNVEIKTVLQQSPDTWQVDWVETSRDRQGIVKGQPVTMRALVTVYTAEVSSQTTD
EQLRNNPMSVFVRDFSWSRIL
Download sequence
Identical sequences Q5NWM2
gi|58616437|ref|YP_195566.1| WP_011255079.1.4884 gi|58616437|ref|YP_195566.1|NC_006824 76114.p2B5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]