SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|49186121|ref|YP_029373.1| from Bacillus anthracis str. Sterne

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|49186121|ref|YP_029373.1|
Domain Number 1 Region: 133-177
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.0000556
Family Surp module (SWAP domain) 0.0045
Further Details:      
 
Weak hits

Sequence:  gi|49186121|ref|YP_029373.1|
Domain Number - Region: 85-186
Classification Level Classification E-value
Superfamily MAPEG domain-like 0.0589
Family MAPEG domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|49186121|ref|YP_029373.1|
Sequence length 240
Comment hypothetical protein BAS3116 [Bacillus anthracis str. Sterne]
Sequence
MKLVIPKQHGAWAMLVIPFLLSVILGKPTIYHIPLFIAWFFIYLATYPFLMYIKQKRKKE
YLHAAIVYFIIAFVFGMISLLYEWRILLFVAVMIPFFIVNMYYARQKNERALRNDISAII
VFCIGGLVSYYFSMKLIDKTALFIALISFLYFLGSTFYVKTMIREKNNPKYRFISWGYHI
LLMIIVFAINPWCSLIFIPSVIRAIILYGKKISIIKVGILEIVNSVYFLIITAIIMKYAI
Download sequence
Identical sequences A0A0F7REZ6 Q81N55
gi|47528646|ref|YP_019995.1| 198094.BA_3362 260799.BAS3116 261594.GBAA3362 568206.BAMEG_1263 592021.BAA_3397 NP_845648.1.87267 WP_000779967.1.100214 WP_000779967.1.100595 WP_000779967.1.10208 WP_000779967.1.11676 WP_000779967.1.13115 WP_000779967.1.13233 WP_000779967.1.13820 WP_000779967.1.14721 WP_000779967.1.14855 WP_000779967.1.15460 WP_000779967.1.15569 WP_000779967.1.16170 WP_000779967.1.16997 WP_000779967.1.17146 WP_000779967.1.18976 WP_000779967.1.19258 WP_000779967.1.19435 WP_000779967.1.20390 WP_000779967.1.20680 WP_000779967.1.21021 WP_000779967.1.21258 WP_000779967.1.21776 WP_000779967.1.22865 WP_000779967.1.2419 WP_000779967.1.24334 WP_000779967.1.24556 WP_000779967.1.24608 WP_000779967.1.25716 WP_000779967.1.25752 WP_000779967.1.2618 WP_000779967.1.26665 WP_000779967.1.26721 WP_000779967.1.27644 WP_000779967.1.27987 WP_000779967.1.28427 WP_000779967.1.28729 WP_000779967.1.29101 WP_000779967.1.29787 WP_000779967.1.30110 WP_000779967.1.3236 WP_000779967.1.32576 WP_000779967.1.33338 WP_000779967.1.33367 WP_000779967.1.33740 WP_000779967.1.33876 WP_000779967.1.34646 WP_000779967.1.35684 WP_000779967.1.35886 WP_000779967.1.36305 WP_000779967.1.36763 WP_000779967.1.38036 WP_000779967.1.39781 WP_000779967.1.40550 WP_000779967.1.41165 WP_000779967.1.41675 WP_000779967.1.4439 WP_000779967.1.45305 WP_000779967.1.45533 WP_000779967.1.46236 WP_000779967.1.46699 WP_000779967.1.47145 WP_000779967.1.4763 WP_000779967.1.47798 WP_000779967.1.52794 WP_000779967.1.53137 WP_000779967.1.53493 WP_000779967.1.53683 WP_000779967.1.54117 WP_000779967.1.54189 WP_000779967.1.55811 WP_000779967.1.55958 WP_000779967.1.56042 WP_000779967.1.56176 WP_000779967.1.56270 WP_000779967.1.56959 WP_000779967.1.58160 WP_000779967.1.59095 WP_000779967.1.59310 WP_000779967.1.59575 WP_000779967.1.60402 WP_000779967.1.61213 WP_000779967.1.63560 WP_000779967.1.68607 WP_000779967.1.69203 WP_000779967.1.69822 WP_000779967.1.69894 WP_000779967.1.70065 WP_000779967.1.72704 WP_000779967.1.73325 WP_000779967.1.74226 WP_000779967.1.74538 WP_000779967.1.75499 WP_000779967.1.75870 WP_000779967.1.76125 WP_000779967.1.76783 WP_000779967.1.77668 WP_000779967.1.77824 WP_000779967.1.78644 WP_000779967.1.79315 WP_000779967.1.79584 WP_000779967.1.80439 WP_000779967.1.80695 WP_000779967.1.81799 WP_000779967.1.82289 WP_000779967.1.83951 WP_000779967.1.84045 WP_000779967.1.85689 WP_000779967.1.86119 WP_000779967.1.86140 WP_000779967.1.86288 WP_000779967.1.8698 WP_000779967.1.8825 WP_000779967.1.88641 WP_000779967.1.90791 WP_000779967.1.90883 WP_000779967.1.9186 WP_000779967.1.92686 WP_000779967.1.92831 WP_000779967.1.93271 WP_000779967.1.93927 WP_000779967.1.94237 WP_000779967.1.94322 WP_000779967.1.94784 WP_000779967.1.96934 WP_000779967.1.97781 WP_000779967.1.97861 WP_000779967.1.98216 WP_000779967.1.99445 WP_000779967.1.99485 YP_029373.1.16718 gi|386737073|ref|YP_006210254.1| gi|229601688|ref|YP_002867531.1| gi|30263271|ref|NP_845648.1| gi|49186121|ref|YP_029373.1| gi|227813858|ref|YP_002813867.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]