SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62289197|ref|YP_220990.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62289197|ref|YP_220990.1|
Domain Number 1 Region: 26-303
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.93e-56
Family Phosphate binding protein-like 0.0000729
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|62289197|ref|YP_220990.1|
Sequence length 304
Comment ABC transporter periplasmic substrate-binding protein [Brucella abortus bv. 1 str. 9-941]
Sequence
MLKGSAFALALFVGAIQFSSLAEAQVAVSSKIDTEGGVLGNIILTVLNANGIKTTDRIQL
GATPVVRKAITAGEIDIYPEYTGNAAFFFNKADDPLWKDPAKAYETAKKLDYDANKIVWL
TPSPANNTWGIAVRKDVANENKLASLSDFGKYIAGGGKVVLAASSEFVNSAAALPAFQTA
YGFTLKPDQLITLSGGDTAATIAAAANQTNGANAAMVYGTDGGIAPSGLVVLEDDKHVQP
VYQPAPIIREEVLKKDPKIEELLKPVFEKLDLTTLQDLNGRVQLGGEPAKAVAEDFLKKN
GFLK
Download sequence
Identical sequences A0A0H3G1N0 A0A2K4NHP2 C7LFS8 Q2YP76 Q57FF5 Q8YF02
gi|340789844|ref|YP_004755308.1| gi|256368686|ref|YP_003106192.1| gi|62289197|ref|YP_220990.1| gi|82699133|ref|YP_413707.1| gi|376279920|ref|YP_005153926.1| gi|23501132|ref|NP_697259.1| gi|17988008|ref|NP_540642.1| 204722.BR0225 224914.BMEI1725 262698.BruAb1_0220 359391.BAB1_0226 568815.BMI_I228 gi|23501132|ref|NP_697259.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]