SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62289289|ref|YP_221082.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62289289|ref|YP_221082.1|
Domain Number 1 Region: 48-277
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.81e-46
Family Phosphate binding protein-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62289289|ref|YP_221082.1|
Sequence length 280
Comment amino acid ABC transporter substrate-binding protein [Brucella abortus bv. 1 str. 9-941]
Sequence
MKSCLLSLTISMCLFAPAAHAAGEEPAAPHFFNQKERLPLPSLQGLNRLRFITTVDFPPF
NRRNERGQLSGYNIDLAKALCQQLKIEDICQIEAVPWAELEERVLDGQADAIIAGWEPTD
RNREKFTFTRSYMRLPARFATSNAKSFTEPAAKATQDKPVGVIAGTAHEALLKNYFPQAK
PVPYPNRDAMLTALKDGKIDTVFDDGMSLSAWLDSAEGSACCTFTDGPYLAPQYLGSGLS
IAVTRQNSALASAFNNALQALQQEGKLTELYLRYFPASFY
Download sequence
Identical sequences A0A0F6AP40 A0A2K4NHX5 C4INB7 Q2YPE4 Q57F63
NYSGRC-SEC-62289289 gi|62289289|ref|YP_221082.1| 262698.BruAb1_0321 359391.BAB1_0325 430066.BAbS19_I02950 WP_002966680.1.100443 WP_002966680.1.102082 WP_002966680.1.10630 WP_002966680.1.11620 WP_002966680.1.12241 WP_002966680.1.13460 WP_002966680.1.13826 WP_002966680.1.14633 WP_002966680.1.16975 WP_002966680.1.19641 WP_002966680.1.20012 WP_002966680.1.22583 WP_002966680.1.24196 WP_002966680.1.24428 WP_002966680.1.24655 WP_002966680.1.25382 WP_002966680.1.26599 WP_002966680.1.2778 WP_002966680.1.2839 WP_002966680.1.2874 WP_002966680.1.31094 WP_002966680.1.31239 WP_002966680.1.32337 WP_002966680.1.33599 WP_002966680.1.33753 WP_002966680.1.35970 WP_002966680.1.39039 WP_002966680.1.39963 WP_002966680.1.40407 WP_002966680.1.40624 WP_002966680.1.40649 WP_002966680.1.40871 WP_002966680.1.41044 WP_002966680.1.42427 WP_002966680.1.43597 WP_002966680.1.4428 WP_002966680.1.45559 WP_002966680.1.46182 WP_002966680.1.46432 WP_002966680.1.47558 WP_002966680.1.47610 WP_002966680.1.50051 WP_002966680.1.50053 WP_002966680.1.50282 WP_002966680.1.5052 WP_002966680.1.5236 WP_002966680.1.53128 WP_002966680.1.53481 WP_002966680.1.5394 WP_002966680.1.54440 WP_002966680.1.55440 WP_002966680.1.55684 WP_002966680.1.56334 WP_002966680.1.56952 WP_002966680.1.57925 WP_002966680.1.58539 WP_002966680.1.59086 WP_002966680.1.61536 WP_002966680.1.61811 WP_002966680.1.61997 WP_002966680.1.63730 WP_002966680.1.64124 WP_002966680.1.64853 WP_002966680.1.64883 WP_002966680.1.64905 WP_002966680.1.65131 WP_002966680.1.65454 WP_002966680.1.66260 WP_002966680.1.66810 WP_002966680.1.67893 WP_002966680.1.67996 WP_002966680.1.67997 WP_002966680.1.69829 WP_002966680.1.70322 WP_002966680.1.71194 WP_002966680.1.71846 WP_002966680.1.72916 WP_002966680.1.75458 WP_002966680.1.76350 WP_002966680.1.76433 WP_002966680.1.77321 WP_002966680.1.78109 WP_002966680.1.7984 WP_002966680.1.79963 WP_002966680.1.80266 WP_002966680.1.80697 WP_002966680.1.81617 WP_002966680.1.8224 WP_002966680.1.8278 WP_002966680.1.8307 WP_002966680.1.8657 WP_002966680.1.87603 WP_002966680.1.87867 WP_002966680.1.8878 WP_002966680.1.90689 WP_002966680.1.91123 WP_002966680.1.91338 WP_002966680.1.92518 WP_002966680.1.93454 WP_002966680.1.94126 WP_002966680.1.94775 WP_002966680.1.97511 WP_002966680.1.97741 WP_002966680.1.98076 WP_002966680.1.98455 WP_002966680.1.99373 WP_002966680.1.99421 gi|82699219|ref|YP_413793.1| gi|189023542|ref|YP_001934310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]