SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62289808|ref|YP_221601.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62289808|ref|YP_221601.1|
Domain Number 1 Region: 5-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.98e-73
Family Phosphate binding protein-like 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62289808|ref|YP_221601.1|
Sequence length 262
Comment amino acid ABC transporter substrate-binding protein [Brucella abortus bv. 1 str. 9-941]
Sequence
MRGFKRIAACAVIAGFAAIGAARAEEPLKLVIGTEGAYPPFNFINPDGSLSGFDVDIARA
LCDEMKAECTFITQEWDGTIPALQAGKFDAYVSSMSITEERKKQVDFSDKYYNTPPGVAA
PKDTDIKGVTKEDLAGKTIGVQVSTTHANYAEQTFTDSTIKAYPTAEEYRLDLANGRLDA
VNDDSVTLSEWLKTPDGACCKMVGTYPPDDAIHGVGVGVAFKKGRPELVEKFNAAIKAIR
KNGKYKEINDKYFDFDAYGAEN
Download sequence
Identical sequences A0A1G4F4P6 A0A1Z1ZP74 A0A2I7WQ73 C0RIJ5 N8NGC7 Q57DP4
gi|62289808|ref|YP_221601.1| gi|225852374|ref|YP_002732607.1| WP_002971474.1.100018 WP_002971474.1.100443 WP_002971474.1.100628 WP_002971474.1.100807 WP_002971474.1.101150 WP_002971474.1.101411 WP_002971474.1.101965 WP_002971474.1.102026 WP_002971474.1.10322 WP_002971474.1.1055 WP_002971474.1.10630 WP_002971474.1.10844 WP_002971474.1.10866 WP_002971474.1.10893 WP_002971474.1.11066 WP_002971474.1.11306 WP_002971474.1.11620 WP_002971474.1.11859 WP_002971474.1.11933 WP_002971474.1.12041 WP_002971474.1.12241 WP_002971474.1.12704 WP_002971474.1.12925 WP_002971474.1.12981 WP_002971474.1.1327 WP_002971474.1.13460 WP_002971474.1.14323 WP_002971474.1.14507 WP_002971474.1.14542 WP_002971474.1.15077 WP_002971474.1.16733 WP_002971474.1.16975 WP_002971474.1.17378 WP_002971474.1.18034 WP_002971474.1.18494 WP_002971474.1.18635 WP_002971474.1.19182 WP_002971474.1.19483 WP_002971474.1.19508 WP_002971474.1.19641 WP_002971474.1.20012 WP_002971474.1.20827 WP_002971474.1.21149 WP_002971474.1.22142 WP_002971474.1.22583 WP_002971474.1.2337 WP_002971474.1.23391 WP_002971474.1.24196 WP_002971474.1.24428 WP_002971474.1.24607 WP_002971474.1.24655 WP_002971474.1.24726 WP_002971474.1.24895 WP_002971474.1.24923 WP_002971474.1.24971 WP_002971474.1.25101 WP_002971474.1.25135 WP_002971474.1.25450 WP_002971474.1.25561 WP_002971474.1.25729 WP_002971474.1.26599 WP_002971474.1.2778 WP_002971474.1.27794 WP_002971474.1.2839 WP_002971474.1.2874 WP_002971474.1.28889 WP_002971474.1.29765 WP_002971474.1.29997 WP_002971474.1.31106 WP_002971474.1.31239 WP_002971474.1.31635 WP_002971474.1.31644 WP_002971474.1.31680 WP_002971474.1.32337 WP_002971474.1.32492 WP_002971474.1.32731 WP_002971474.1.32779 WP_002971474.1.33032 WP_002971474.1.33289 WP_002971474.1.33466 WP_002971474.1.33599 WP_002971474.1.33907 WP_002971474.1.34183 WP_002971474.1.34353 WP_002971474.1.34423 WP_002971474.1.35056 WP_002971474.1.35338 WP_002971474.1.35577 WP_002971474.1.35970 WP_002971474.1.36149 WP_002971474.1.36712 WP_002971474.1.37797 WP_002971474.1.38353 WP_002971474.1.38925 WP_002971474.1.39021 WP_002971474.1.39039 WP_002971474.1.39963 WP_002971474.1.40138 WP_002971474.1.40189 WP_002971474.1.40407 WP_002971474.1.40624 WP_002971474.1.4091 WP_002971474.1.41044 WP_002971474.1.41105 WP_002971474.1.41311 WP_002971474.1.41344 WP_002971474.1.41835 WP_002971474.1.41950 WP_002971474.1.42065 WP_002971474.1.4207 WP_002971474.1.42103 WP_002971474.1.42427 WP_002971474.1.42633 WP_002971474.1.42774 WP_002971474.1.4295 WP_002971474.1.43058 WP_002971474.1.43148 WP_002971474.1.4319 WP_002971474.1.43359 WP_002971474.1.43583 WP_002971474.1.43597 WP_002971474.1.44045 WP_002971474.1.44060 WP_002971474.1.4428 WP_002971474.1.44541 WP_002971474.1.44793 WP_002971474.1.44989 WP_002971474.1.45559 WP_002971474.1.46182 WP_002971474.1.46432 WP_002971474.1.4727 WP_002971474.1.47516 WP_002971474.1.47545 WP_002971474.1.47558 WP_002971474.1.47610 WP_002971474.1.47843 WP_002971474.1.48075 WP_002971474.1.48184 WP_002971474.1.48396 WP_002971474.1.4847 WP_002971474.1.48727 WP_002971474.1.48744 WP_002971474.1.48948 WP_002971474.1.49089 WP_002971474.1.49640 WP_002971474.1.49942 WP_002971474.1.49953 WP_002971474.1.50051 WP_002971474.1.50053 WP_002971474.1.5052 WP_002971474.1.50924 WP_002971474.1.50952 WP_002971474.1.51553 WP_002971474.1.5236 WP_002971474.1.52478 WP_002971474.1.52541 WP_002971474.1.53128 WP_002971474.1.53481 WP_002971474.1.53843 WP_002971474.1.5394 WP_002971474.1.54481 WP_002971474.1.54776 WP_002971474.1.54779 WP_002971474.1.55047 WP_002971474.1.55284 WP_002971474.1.55440 WP_002971474.1.55585 WP_002971474.1.55684 WP_002971474.1.5609 WP_002971474.1.56334 WP_002971474.1.56621 WP_002971474.1.56683 WP_002971474.1.56687 WP_002971474.1.56947 WP_002971474.1.57541 WP_002971474.1.58525 WP_002971474.1.58539 WP_002971474.1.59086 WP_002971474.1.59985 WP_002971474.1.60134 WP_002971474.1.60920 WP_002971474.1.61081 WP_002971474.1.61325 WP_002971474.1.61543 WP_002971474.1.61811 WP_002971474.1.61961 WP_002971474.1.61997 WP_002971474.1.62990 WP_002971474.1.62997 WP_002971474.1.63628 WP_002971474.1.64013 WP_002971474.1.64124 WP_002971474.1.6440 WP_002971474.1.64585 WP_002971474.1.64853 WP_002971474.1.64905 WP_002971474.1.65131 WP_002971474.1.65199 WP_002971474.1.65454 WP_002971474.1.65501 WP_002971474.1.65597 WP_002971474.1.65625 WP_002971474.1.66078 WP_002971474.1.66260 WP_002971474.1.66407 WP_002971474.1.66647 WP_002971474.1.66810 WP_002971474.1.66855 WP_002971474.1.67107 WP_002971474.1.67659 WP_002971474.1.67996 WP_002971474.1.67997 WP_002971474.1.68913 WP_002971474.1.6942 WP_002971474.1.69451 WP_002971474.1.69522 WP_002971474.1.69829 WP_002971474.1.69997 WP_002971474.1.70160 WP_002971474.1.70296 WP_002971474.1.70322 WP_002971474.1.70760 WP_002971474.1.71194 WP_002971474.1.71228 WP_002971474.1.71689 WP_002971474.1.71846 WP_002971474.1.7206 WP_002971474.1.72189 WP_002971474.1.72916 WP_002971474.1.73628 WP_002971474.1.73739 WP_002971474.1.7388 WP_002971474.1.7410 WP_002971474.1.74236 WP_002971474.1.75128 WP_002971474.1.75434 WP_002971474.1.75458 WP_002971474.1.75563 WP_002971474.1.75678 WP_002971474.1.75766 WP_002971474.1.76350 WP_002971474.1.7667 WP_002971474.1.76877 WP_002971474.1.77281 WP_002971474.1.77321 WP_002971474.1.77685 WP_002971474.1.77899 WP_002971474.1.78109 WP_002971474.1.78225 WP_002971474.1.78590 WP_002971474.1.79327 WP_002971474.1.79963 WP_002971474.1.79993 WP_002971474.1.80059 WP_002971474.1.8012 WP_002971474.1.80167 WP_002971474.1.80266 WP_002971474.1.80476 WP_002971474.1.81276 WP_002971474.1.81377 WP_002971474.1.81674 WP_002971474.1.81822 WP_002971474.1.8224 WP_002971474.1.82390 WP_002971474.1.82448 WP_002971474.1.82565 WP_002971474.1.82595 WP_002971474.1.8278 WP_002971474.1.82834 WP_002971474.1.82990 WP_002971474.1.8307 WP_002971474.1.83513 WP_002971474.1.84207 WP_002971474.1.84540 WP_002971474.1.84601 WP_002971474.1.84764 WP_002971474.1.85322 WP_002971474.1.85684 WP_002971474.1.85753 WP_002971474.1.85769 WP_002971474.1.8657 WP_002971474.1.86832 WP_002971474.1.86901 WP_002971474.1.87222 WP_002971474.1.87522 WP_002971474.1.87603 WP_002971474.1.87867 WP_002971474.1.8788 WP_002971474.1.88404 WP_002971474.1.88424 WP_002971474.1.88658 WP_002971474.1.8878 WP_002971474.1.88867 WP_002971474.1.89113 WP_002971474.1.9096 WP_002971474.1.91081 WP_002971474.1.91123 WP_002971474.1.91338 WP_002971474.1.9163 WP_002971474.1.91710 WP_002971474.1.91768 WP_002971474.1.92383 WP_002971474.1.9303 WP_002971474.1.93230 WP_002971474.1.93454 WP_002971474.1.93795 WP_002971474.1.94126 WP_002971474.1.94513 WP_002971474.1.94555 WP_002971474.1.94648 WP_002971474.1.94775 WP_002971474.1.95141 WP_002971474.1.95178 WP_002971474.1.95770 WP_002971474.1.96661 WP_002971474.1.96710 WP_002971474.1.97240 WP_002971474.1.97320 WP_002971474.1.97331 WP_002971474.1.97741 WP_002971474.1.97860 WP_002971474.1.98455 WP_002971474.1.98764 WP_002971474.1.99221 WP_002971474.1.99373 WP_002971474.1.99421 262698.BruAb1_0874 546272.BMEA_A0900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]