SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62290105|ref|YP_221898.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62290105|ref|YP_221898.1|
Domain Number 1 Region: 31-328
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.11e-74
Family Phosphate binding protein-like 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62290105|ref|YP_221898.1|
Sequence length 329
Comment hypothetical protein BruAb1_1199 [Brucella abortus bv. 1 str. 9-941]
Sequence
MKFGSKIRRLAVAAVAGAIALGASFAVAQAPTFFRIGTGGTAGTYYPIGGLIANAISGAG
EKGVPGLVATAVSSNGSVANINAIKSGALESGFTQSDVAYWAYNGTGLYDGKGKVEDLRL
LATLYPETIHIVARKDANIKSVADLKGKRVSLDEPGSGTIVDARIVLEAYGLTEDDIKAE
HLKPGPAGERLKDGALDAYFFVGGYPTGAISELAISNGISLVPISGPEADKILEKYSFFS
KDVVPAGAYKDVAETPTLAVAAQWVTSAKQPDDLIYNITKVLWNEDTRKALDAGHAKGKL
IKLDSATSSLGIPLHPGAERFYKEAGVLK
Download sequence
Identical sequences A0A0E1X2J8 A0A0F6AR43 A0A0M1WAR3 A0A1X9RU67 A0A2D3K5L2 A0A2I7WR06 A9M5L0 B0CGZ2 C0RJG1 C7LCE4 D0RJ99 D6LKN4 D7GYU2 P0A3T2 P0A3T3 Q2YRV5
WP_002964322.1.100018 WP_002964322.1.100204 WP_002964322.1.100443 WP_002964322.1.100628 WP_002964322.1.100807 WP_002964322.1.101247 WP_002964322.1.101411 WP_002964322.1.101965 WP_002964322.1.102026 WP_002964322.1.102082 WP_002964322.1.10307 WP_002964322.1.10322 WP_002964322.1.1055 WP_002964322.1.10630 WP_002964322.1.10844 WP_002964322.1.10866 WP_002964322.1.10893 WP_002964322.1.11066 WP_002964322.1.1158 WP_002964322.1.11620 WP_002964322.1.11769 WP_002964322.1.11859 WP_002964322.1.11933 WP_002964322.1.12041 WP_002964322.1.12241 WP_002964322.1.12704 WP_002964322.1.12925 WP_002964322.1.12981 WP_002964322.1.1327 WP_002964322.1.13460 WP_002964322.1.13576 WP_002964322.1.13826 WP_002964322.1.14323 WP_002964322.1.14542 WP_002964322.1.14633 WP_002964322.1.15077 WP_002964322.1.16733 WP_002964322.1.16975 WP_002964322.1.17378 WP_002964322.1.17733 WP_002964322.1.1800 WP_002964322.1.18034 WP_002964322.1.18494 WP_002964322.1.18635 WP_002964322.1.19182 WP_002964322.1.19483 WP_002964322.1.19508 WP_002964322.1.19641 WP_002964322.1.19645 WP_002964322.1.20012 WP_002964322.1.20317 WP_002964322.1.2214 WP_002964322.1.22142 WP_002964322.1.22340 WP_002964322.1.22583 WP_002964322.1.2337 WP_002964322.1.23391 WP_002964322.1.23458 WP_002964322.1.24196 WP_002964322.1.24428 WP_002964322.1.24496 WP_002964322.1.24607 WP_002964322.1.24655 WP_002964322.1.24726 WP_002964322.1.2483 WP_002964322.1.24895 WP_002964322.1.24923 WP_002964322.1.24971 WP_002964322.1.25101 WP_002964322.1.25135 WP_002964322.1.25382 WP_002964322.1.25450 WP_002964322.1.25561 WP_002964322.1.25729 WP_002964322.1.26599 WP_002964322.1.27052 WP_002964322.1.2778 WP_002964322.1.27794 WP_002964322.1.2839 WP_002964322.1.2874 WP_002964322.1.2877 WP_002964322.1.28889 WP_002964322.1.29765 WP_002964322.1.29997 WP_002964322.1.31106 WP_002964322.1.31239 WP_002964322.1.31463 WP_002964322.1.31635 WP_002964322.1.31644 WP_002964322.1.31680 WP_002964322.1.32337 WP_002964322.1.32492 WP_002964322.1.32731 WP_002964322.1.32779 WP_002964322.1.33032 WP_002964322.1.33220 WP_002964322.1.33289 WP_002964322.1.33466 WP_002964322.1.33599 WP_002964322.1.33753 WP_002964322.1.3390 WP_002964322.1.34183 WP_002964322.1.34225 WP_002964322.1.34353 WP_002964322.1.34423 WP_002964322.1.35056 WP_002964322.1.35338 WP_002964322.1.35577 WP_002964322.1.35970 WP_002964322.1.36149 WP_002964322.1.36712 WP_002964322.1.3681 WP_002964322.1.37797 WP_002964322.1.38353 WP_002964322.1.38790 WP_002964322.1.38925 WP_002964322.1.39021 WP_002964322.1.39039 WP_002964322.1.39963 WP_002964322.1.40138 WP_002964322.1.40189 WP_002964322.1.40407 WP_002964322.1.40624 WP_002964322.1.40649 WP_002964322.1.408 WP_002964322.1.40871 WP_002964322.1.4091 WP_002964322.1.41044 WP_002964322.1.41105 WP_002964322.1.41311 WP_002964322.1.41344 WP_002964322.1.41835 WP_002964322.1.41893 WP_002964322.1.41941 WP_002964322.1.41950 WP_002964322.1.42065 WP_002964322.1.42071 WP_002964322.1.42103 WP_002964322.1.42427 WP_002964322.1.42633 WP_002964322.1.42774 WP_002964322.1.4295 WP_002964322.1.43058 WP_002964322.1.43148 WP_002964322.1.4319 WP_002964322.1.43359 WP_002964322.1.43583 WP_002964322.1.43597 WP_002964322.1.44045 WP_002964322.1.44060 WP_002964322.1.4428 WP_002964322.1.44294 WP_002964322.1.44541 WP_002964322.1.44793 WP_002964322.1.44949 WP_002964322.1.44989 WP_002964322.1.45546 WP_002964322.1.45559 WP_002964322.1.46182 WP_002964322.1.46432 WP_002964322.1.4727 WP_002964322.1.47516 WP_002964322.1.47558 WP_002964322.1.47610 WP_002964322.1.48075 WP_002964322.1.48184 WP_002964322.1.48396 WP_002964322.1.4847 WP_002964322.1.48744 WP_002964322.1.49089 WP_002964322.1.49427 WP_002964322.1.49542 WP_002964322.1.49640 WP_002964322.1.49953 WP_002964322.1.50051 WP_002964322.1.50053 WP_002964322.1.50282 WP_002964322.1.5052 WP_002964322.1.50924 WP_002964322.1.51553 WP_002964322.1.52027 WP_002964322.1.5236 WP_002964322.1.52478 WP_002964322.1.52541 WP_002964322.1.5307 WP_002964322.1.53128 WP_002964322.1.53481 WP_002964322.1.5394 WP_002964322.1.54440 WP_002964322.1.54481 WP_002964322.1.54776 WP_002964322.1.54779 WP_002964322.1.55047 WP_002964322.1.55284 WP_002964322.1.55440 WP_002964322.1.55684 WP_002964322.1.5609 WP_002964322.1.56334 WP_002964322.1.56621 WP_002964322.1.56683 WP_002964322.1.56687 WP_002964322.1.56952 WP_002964322.1.57541 WP_002964322.1.57564 WP_002964322.1.57925 WP_002964322.1.58525 WP_002964322.1.58539 WP_002964322.1.58868 WP_002964322.1.59086 WP_002964322.1.59515 WP_002964322.1.59985 WP_002964322.1.60134 WP_002964322.1.60920 WP_002964322.1.61081 WP_002964322.1.61325 WP_002964322.1.61536 WP_002964322.1.61543 WP_002964322.1.61811 WP_002964322.1.61961 WP_002964322.1.61997 WP_002964322.1.62872 WP_002964322.1.62990 WP_002964322.1.62997 WP_002964322.1.63730 WP_002964322.1.63732 WP_002964322.1.64013 WP_002964322.1.64124 WP_002964322.1.6440 WP_002964322.1.64585 WP_002964322.1.64849 WP_002964322.1.64853 WP_002964322.1.64905 WP_002964322.1.65131 WP_002964322.1.65454 WP_002964322.1.65501 WP_002964322.1.6555 WP_002964322.1.65597 WP_002964322.1.65625 WP_002964322.1.65651 WP_002964322.1.66078 WP_002964322.1.66260 WP_002964322.1.66268 WP_002964322.1.66340 WP_002964322.1.66407 WP_002964322.1.66647 WP_002964322.1.66810 WP_002964322.1.66855 WP_002964322.1.67107 WP_002964322.1.67402 WP_002964322.1.67659 WP_002964322.1.67893 WP_002964322.1.67996 WP_002964322.1.67997 WP_002964322.1.68488 WP_002964322.1.68913 WP_002964322.1.6942 WP_002964322.1.69451 WP_002964322.1.69522 WP_002964322.1.69829 WP_002964322.1.69997 WP_002964322.1.70160 WP_002964322.1.70296 WP_002964322.1.70322 WP_002964322.1.70570 WP_002964322.1.70760 WP_002964322.1.71002 WP_002964322.1.71194 WP_002964322.1.71228 WP_002964322.1.71689 WP_002964322.1.71846 WP_002964322.1.7206 WP_002964322.1.72189 WP_002964322.1.72439 WP_002964322.1.72533 WP_002964322.1.72916 WP_002964322.1.73628 WP_002964322.1.73739 WP_002964322.1.7388 WP_002964322.1.74005 WP_002964322.1.74236 WP_002964322.1.75128 WP_002964322.1.75434 WP_002964322.1.75458 WP_002964322.1.75563 WP_002964322.1.75678 WP_002964322.1.75766 WP_002964322.1.76350 WP_002964322.1.76433 WP_002964322.1.7667 WP_002964322.1.76877 WP_002964322.1.77165 WP_002964322.1.77281 WP_002964322.1.77321 WP_002964322.1.77683 WP_002964322.1.77685 WP_002964322.1.77899 WP_002964322.1.78109 WP_002964322.1.78716 WP_002964322.1.78821 WP_002964322.1.79327 WP_002964322.1.7984 WP_002964322.1.79963 WP_002964322.1.79993 WP_002964322.1.80059 WP_002964322.1.8012 WP_002964322.1.80167 WP_002964322.1.80266 WP_002964322.1.80476 WP_002964322.1.80697 WP_002964322.1.81027 WP_002964322.1.81377 WP_002964322.1.81558 WP_002964322.1.81617 WP_002964322.1.81822 WP_002964322.1.82113 WP_002964322.1.82205 WP_002964322.1.8223 WP_002964322.1.8224 WP_002964322.1.82390 WP_002964322.1.82448 WP_002964322.1.82753 WP_002964322.1.8278 WP_002964322.1.82834 WP_002964322.1.82990 WP_002964322.1.8307 WP_002964322.1.83161 WP_002964322.1.83513 WP_002964322.1.84512 WP_002964322.1.84601 WP_002964322.1.84764 WP_002964322.1.85322 WP_002964322.1.85684 WP_002964322.1.85721 WP_002964322.1.85753 WP_002964322.1.85769 WP_002964322.1.8657 WP_002964322.1.86832 WP_002964322.1.86901 WP_002964322.1.86923 WP_002964322.1.87522 WP_002964322.1.87603 WP_002964322.1.87867 WP_002964322.1.8788 WP_002964322.1.87893 WP_002964322.1.88404 WP_002964322.1.88658 WP_002964322.1.8878 WP_002964322.1.88867 WP_002964322.1.89113 WP_002964322.1.90027 WP_002964322.1.90420 WP_002964322.1.90689 WP_002964322.1.9096 WP_002964322.1.91081 WP_002964322.1.91123 WP_002964322.1.91338 WP_002964322.1.91710 WP_002964322.1.92383 WP_002964322.1.92518 WP_002964322.1.9303 WP_002964322.1.93230 WP_002964322.1.93367 WP_002964322.1.93454 WP_002964322.1.93795 WP_002964322.1.94126 WP_002964322.1.94555 WP_002964322.1.94770 WP_002964322.1.94775 WP_002964322.1.95141 WP_002964322.1.95148 WP_002964322.1.95178 WP_002964322.1.95770 WP_002964322.1.96661 WP_002964322.1.96710 WP_002964322.1.97320 WP_002964322.1.97331 WP_002964322.1.97511 WP_002964322.1.97741 WP_002964322.1.97860 WP_002964322.1.98076 WP_002964322.1.98362 WP_002964322.1.98455 WP_002964322.1.98704 WP_002964322.1.98764 WP_002964322.1.99221 WP_002964322.1.99373 WP_002964322.1.99421 gi|225852690|ref|YP_002732923.1| 224914.BMEI0796 262698.BruAb1_1199 359391.BAB1_1216 430066.BAbS19_I11320 470137.BSUIS_A1242 483179.BCAN_A1216 546272.BMEA_A1238 568815.BMI_I1205 gi|62290105|ref|YP_221898.1| gi|163843459|ref|YP_001627863.1| gi|189024343|ref|YP_001935111.1| gi|340790812|ref|YP_004756277.1| gi|161619149|ref|YP_001593036.1| gi|376276198|ref|YP_005116637.1| gi|384408665|ref|YP_005597286.1| gi|560147001|ref|YP_008839817.1| gi|17987079|ref|NP_539713.1| gi|82700028|ref|YP_414602.1| gi|256369618|ref|YP_003107128.1| gi|384211558|ref|YP_005600640.1| gi|376273079|ref|YP_005151657.1| gi|384445248|ref|YP_005603967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]