SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62290231|ref|YP_222024.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62290231|ref|YP_222024.1|
Domain Number 1 Region: 24-331
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.73e-79
Family Phosphate binding protein-like 0.0000000321
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|62290231|ref|YP_222024.1|
Sequence length 334
Comment sulfate ABC transporter substrate-binding protein [Brucella abortus bv. 1 str. 9-941]
Sequence
MRKIILYAAVALGLGAAPVQAQEPNEILNVSYDIARELYEQINQAFVADWKARTGQELTV
NQSHAGSSKQARSILEGLEADVVTFNQVVDVQVLHDKGNLIPADWQKRLPNNSSPYYSFP
AFLVREGNPKHIKNWDDLARDDVKVIFPNPKTSGNARYTYLAATAYANEAFKGDKEKVKE
FIGKIFSNVPVFDTGGRGATTTFAERGLGDVLVTFEAETRGTEKMLGPDKYDVVVPEMSL
LAEFPVTVVDTVVDKRGSRRIAEAYLDYLYSPAGQEILAQNFNRVHDKDVIAKHKDIYPD
VRLVTVEEAFGGWDKVQKEHFSEGGVLDQLFTGK
Download sequence
Identical sequences A0A0E1X2Z8 A0A0F6ARC5 A0A0H3G825 A0A0M1WBN4 A0A2D2BQ40 A0A2K4NKQ1 A9M5Y8 B0CHC3 C7LCS6 C9VBC0 D0RJM7 D1CYS4 D7GZ63 E2PSG9 Q2YQF2 Q57CH1
gi|340790947|ref|YP_004756412.1| gi|163843590|ref|YP_001627994.1| WP_002964447.1.100018 WP_002964447.1.100204 WP_002964447.1.100443 WP_002964447.1.101965 WP_002964447.1.102082 WP_002964447.1.10307 WP_002964447.1.10630 WP_002964447.1.10893 WP_002964447.1.11306 WP_002964447.1.1158 WP_002964447.1.11620 WP_002964447.1.12241 WP_002964447.1.13020 WP_002964447.1.13460 WP_002964447.1.13576 WP_002964447.1.13592 WP_002964447.1.13826 WP_002964447.1.14542 WP_002964447.1.14633 WP_002964447.1.15077 WP_002964447.1.15325 WP_002964447.1.16733 WP_002964447.1.16975 WP_002964447.1.17378 WP_002964447.1.17733 WP_002964447.1.1800 WP_002964447.1.18034 WP_002964447.1.18635 WP_002964447.1.19508 WP_002964447.1.19641 WP_002964447.1.20012 WP_002964447.1.20317 WP_002964447.1.2214 WP_002964447.1.22340 WP_002964447.1.22583 WP_002964447.1.2337 WP_002964447.1.24196 WP_002964447.1.24428 WP_002964447.1.24496 WP_002964447.1.24655 WP_002964447.1.24726 WP_002964447.1.2483 WP_002964447.1.25101 WP_002964447.1.25382 WP_002964447.1.25561 WP_002964447.1.25729 WP_002964447.1.26599 WP_002964447.1.27052 WP_002964447.1.2778 WP_002964447.1.2839 WP_002964447.1.2874 WP_002964447.1.2877 WP_002964447.1.28889 WP_002964447.1.31094 WP_002964447.1.31106 WP_002964447.1.31239 WP_002964447.1.31463 WP_002964447.1.32337 WP_002964447.1.32492 WP_002964447.1.32731 WP_002964447.1.33220 WP_002964447.1.33599 WP_002964447.1.33753 WP_002964447.1.34225 WP_002964447.1.34353 WP_002964447.1.35056 WP_002964447.1.35970 WP_002964447.1.37797 WP_002964447.1.38353 WP_002964447.1.38790 WP_002964447.1.38925 WP_002964447.1.39021 WP_002964447.1.39039 WP_002964447.1.39963 WP_002964447.1.40138 WP_002964447.1.40407 WP_002964447.1.40624 WP_002964447.1.40649 WP_002964447.1.408 WP_002964447.1.40871 WP_002964447.1.41044 WP_002964447.1.41835 WP_002964447.1.41941 WP_002964447.1.41950 WP_002964447.1.4207 WP_002964447.1.42071 WP_002964447.1.42427 WP_002964447.1.43006 WP_002964447.1.43359 WP_002964447.1.43583 WP_002964447.1.43597 WP_002964447.1.43689 WP_002964447.1.43928 WP_002964447.1.4428 WP_002964447.1.44294 WP_002964447.1.44793 WP_002964447.1.44949 WP_002964447.1.44989 WP_002964447.1.45546 WP_002964447.1.45559 WP_002964447.1.46182 WP_002964447.1.46432 WP_002964447.1.47558 WP_002964447.1.47610 WP_002964447.1.4847 WP_002964447.1.48744 WP_002964447.1.49542 WP_002964447.1.49640 WP_002964447.1.49753 WP_002964447.1.49953 WP_002964447.1.50051 WP_002964447.1.50053 WP_002964447.1.50282 WP_002964447.1.5052 WP_002964447.1.5236 WP_002964447.1.5307 WP_002964447.1.53128 WP_002964447.1.53481 WP_002964447.1.5394 WP_002964447.1.54440 WP_002964447.1.54776 WP_002964447.1.54779 WP_002964447.1.55440 WP_002964447.1.55684 WP_002964447.1.56313 WP_002964447.1.56334 WP_002964447.1.56683 WP_002964447.1.56952 WP_002964447.1.57564 WP_002964447.1.57925 WP_002964447.1.58260 WP_002964447.1.58525 WP_002964447.1.58539 WP_002964447.1.58868 WP_002964447.1.59086 WP_002964447.1.59091 WP_002964447.1.59515 WP_002964447.1.5971 WP_002964447.1.59985 WP_002964447.1.60631 WP_002964447.1.61536 WP_002964447.1.61811 WP_002964447.1.61997 WP_002964447.1.62592 WP_002964447.1.63730 WP_002964447.1.63732 WP_002964447.1.64013 WP_002964447.1.64124 WP_002964447.1.64849 WP_002964447.1.64853 WP_002964447.1.64883 WP_002964447.1.64905 WP_002964447.1.65131 WP_002964447.1.65299 WP_002964447.1.65454 WP_002964447.1.6555 WP_002964447.1.65625 WP_002964447.1.65651 WP_002964447.1.66078 WP_002964447.1.66260 WP_002964447.1.66810 WP_002964447.1.67402 WP_002964447.1.67996 WP_002964447.1.67997 WP_002964447.1.68488 WP_002964447.1.68913 WP_002964447.1.69451 WP_002964447.1.69829 WP_002964447.1.70296 WP_002964447.1.70322 WP_002964447.1.70570 WP_002964447.1.71002 WP_002964447.1.71077 WP_002964447.1.71194 WP_002964447.1.71689 WP_002964447.1.71846 WP_002964447.1.72012 WP_002964447.1.7206 WP_002964447.1.72439 WP_002964447.1.72916 WP_002964447.1.74005 WP_002964447.1.75434 WP_002964447.1.75458 WP_002964447.1.75766 WP_002964447.1.76350 WP_002964447.1.76433 WP_002964447.1.77165 WP_002964447.1.77321 WP_002964447.1.77899 WP_002964447.1.78109 WP_002964447.1.78716 WP_002964447.1.78821 WP_002964447.1.7984 WP_002964447.1.79963 WP_002964447.1.8012 WP_002964447.1.80266 WP_002964447.1.80365 WP_002964447.1.80476 WP_002964447.1.80697 WP_002964447.1.81558 WP_002964447.1.81617 WP_002964447.1.81822 WP_002964447.1.82113 WP_002964447.1.8223 WP_002964447.1.8224 WP_002964447.1.82595 WP_002964447.1.8278 WP_002964447.1.8307 WP_002964447.1.83513 WP_002964447.1.84512 WP_002964447.1.85322 WP_002964447.1.85721 WP_002964447.1.85769 WP_002964447.1.8657 WP_002964447.1.87522 WP_002964447.1.87603 WP_002964447.1.87867 WP_002964447.1.88404 WP_002964447.1.8878 WP_002964447.1.90027 WP_002964447.1.90689 WP_002964447.1.91123 WP_002964447.1.91338 WP_002964447.1.91710 WP_002964447.1.91958 WP_002964447.1.92518 WP_002964447.1.9303 WP_002964447.1.93230 WP_002964447.1.93454 WP_002964447.1.93795 WP_002964447.1.94126 WP_002964447.1.94555 WP_002964447.1.94770 WP_002964447.1.94775 WP_002964447.1.95148 WP_002964447.1.97511 WP_002964447.1.97741 WP_002964447.1.98076 WP_002964447.1.98362 WP_002964447.1.98455 WP_002964447.1.98704 WP_002964447.1.99221 WP_002964447.1.99373 WP_002964447.1.99421 gi|23502202|ref|NP_698329.1| 204722.BR1330 262698.BruAb1_1330 359391.BAB1_1351 430066.BAbS19_I12620 470137.BSUIS_A1380 483179.BCAN_A1355 568815.BMI_I1342 gi|82700154|ref|YP_414728.1| gi|560146886|ref|YP_008839702.1| gi|376276057|ref|YP_005116496.1| gi|376272935|ref|YP_005151513.1| gi|62290231|ref|YP_222024.1| gi|256369750|ref|YP_003107260.1| gi|23502202|ref|NP_698329.1| gi|189024465|ref|YP_001935233.1| gi|161619277|ref|YP_001593164.1| gi|376280996|ref|YP_005155002.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]