SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62290805|ref|YP_222598.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62290805|ref|YP_222598.1|
Domain Number 1 Region: 4-265
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.37e-57
Family Phosphate binding protein-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62290805|ref|YP_222598.1|
Sequence length 281
Comment amino acid ABC transporter substrate-binding protein [Brucella abortus bv. 1 str. 9-941]
Sequence
MHKKKILAIALLGVCCAISTVAPGMAETTLEKIQRTKKVTVGTEAAYPPFEFVKDGKIVG
FGRDLLDEIAKQWGVEVEQLDLPFQGILPGLIAGKFDFVATSVGINPERAKRYAYTLPIA
DSTAYAIKKAGNDEIKTVEDLKGKVVSTQLASAVDPVAKHLDKRLEASSGEGFADLKLFP
TFNDSFLAVANGTSDAALAGLPVLQNLMNQRPGIFELVGKASDIPSYNAWVVRPEDQDLR
DALNKAILKIKQDGTFAKLQQKWLGMTYALPEKDYLPDGAR
Download sequence
Identical sequences A0A0F6ASR3 A0A0H3G8V7 A0A0M1WCQ3 A0A2D2BRD2 A0A2I7WSV3 C7LEI1 D7H061 Q2YLW5 Q57AU7
gi|376272327|ref|YP_005150905.1| gi|82700715|ref|YP_415289.1| gi|189025020|ref|YP_001935788.1| gi|376281598|ref|YP_005155604.1| gi|23502803|ref|NP_698930.1| gi|62290805|ref|YP_222598.1| gi|23502803|ref|NP_698930.1| gi|256370354|ref|YP_003107865.1| NYSGRC-SEC-23502803 WP_002965019.1.100443 WP_002965019.1.101965 WP_002965019.1.102082 WP_002965019.1.10322 WP_002965019.1.10630 WP_002965019.1.10893 WP_002965019.1.11620 WP_002965019.1.12041 WP_002965019.1.12241 WP_002965019.1.13020 WP_002965019.1.13460 WP_002965019.1.13592 WP_002965019.1.13826 WP_002965019.1.14542 WP_002965019.1.14633 WP_002965019.1.15077 WP_002965019.1.15325 WP_002965019.1.16975 WP_002965019.1.17378 WP_002965019.1.18034 WP_002965019.1.18635 WP_002965019.1.19508 WP_002965019.1.19641 WP_002965019.1.20012 WP_002965019.1.22583 WP_002965019.1.2337 WP_002965019.1.24196 WP_002965019.1.24428 WP_002965019.1.24655 WP_002965019.1.24726 WP_002965019.1.25101 WP_002965019.1.25382 WP_002965019.1.25729 WP_002965019.1.26599 WP_002965019.1.2778 WP_002965019.1.2839 WP_002965019.1.2874 WP_002965019.1.2877 WP_002965019.1.28889 WP_002965019.1.31106 WP_002965019.1.31239 WP_002965019.1.32337 WP_002965019.1.32492 WP_002965019.1.32731 WP_002965019.1.33220 WP_002965019.1.33599 WP_002965019.1.33753 WP_002965019.1.34353 WP_002965019.1.35056 WP_002965019.1.37797 WP_002965019.1.38343 WP_002965019.1.38353 WP_002965019.1.39021 WP_002965019.1.39039 WP_002965019.1.39963 WP_002965019.1.40407 WP_002965019.1.40624 WP_002965019.1.40649 WP_002965019.1.40871 WP_002965019.1.41044 WP_002965019.1.41311 WP_002965019.1.41835 WP_002965019.1.41893 WP_002965019.1.42103 WP_002965019.1.42427 WP_002965019.1.43006 WP_002965019.1.43597 WP_002965019.1.43689 WP_002965019.1.43928 WP_002965019.1.4428 WP_002965019.1.45559 WP_002965019.1.46182 WP_002965019.1.46432 WP_002965019.1.4727 WP_002965019.1.47558 WP_002965019.1.47610 WP_002965019.1.4847 WP_002965019.1.48744 WP_002965019.1.49640 WP_002965019.1.49753 WP_002965019.1.50051 WP_002965019.1.50053 WP_002965019.1.50282 WP_002965019.1.5052 WP_002965019.1.5236 WP_002965019.1.53128 WP_002965019.1.53481 WP_002965019.1.5394 WP_002965019.1.54440 WP_002965019.1.54776 WP_002965019.1.54779 WP_002965019.1.55440 WP_002965019.1.55684 WP_002965019.1.56313 WP_002965019.1.56334 WP_002965019.1.56683 WP_002965019.1.56952 WP_002965019.1.57925 WP_002965019.1.58260 WP_002965019.1.58525 WP_002965019.1.58539 WP_002965019.1.59086 WP_002965019.1.59091 WP_002965019.1.59515 WP_002965019.1.5971 WP_002965019.1.60631 WP_002965019.1.61325 WP_002965019.1.61536 WP_002965019.1.61811 WP_002965019.1.61997 WP_002965019.1.62592 WP_002965019.1.63730 WP_002965019.1.64013 WP_002965019.1.64124 WP_002965019.1.64853 WP_002965019.1.64905 WP_002965019.1.65131 WP_002965019.1.65299 WP_002965019.1.65454 WP_002965019.1.65625 WP_002965019.1.66260 WP_002965019.1.66810 WP_002965019.1.67893 WP_002965019.1.67997 WP_002965019.1.68913 WP_002965019.1.69451 WP_002965019.1.69829 WP_002965019.1.70322 WP_002965019.1.70570 WP_002965019.1.71194 WP_002965019.1.71689 WP_002965019.1.71846 WP_002965019.1.7206 WP_002965019.1.72916 WP_002965019.1.75434 WP_002965019.1.75458 WP_002965019.1.75766 WP_002965019.1.76350 WP_002965019.1.76433 WP_002965019.1.77321 WP_002965019.1.77899 WP_002965019.1.78109 WP_002965019.1.7984 WP_002965019.1.79963 WP_002965019.1.80266 WP_002965019.1.80365 WP_002965019.1.80476 WP_002965019.1.80697 WP_002965019.1.81617 WP_002965019.1.81822 WP_002965019.1.82113 WP_002965019.1.8224 WP_002965019.1.8278 WP_002965019.1.8307 WP_002965019.1.83513 WP_002965019.1.85322 WP_002965019.1.85769 WP_002965019.1.8657 WP_002965019.1.87522 WP_002965019.1.87603 WP_002965019.1.87867 WP_002965019.1.8788 WP_002965019.1.88404 WP_002965019.1.8878 WP_002965019.1.90689 WP_002965019.1.91338 WP_002965019.1.91710 WP_002965019.1.91958 WP_002965019.1.92518 WP_002965019.1.93454 WP_002965019.1.93795 WP_002965019.1.94126 WP_002965019.1.94555 WP_002965019.1.94775 WP_002965019.1.97511 WP_002965019.1.97741 WP_002965019.1.98076 WP_002965019.1.98455 WP_002965019.1.99221 WP_002965019.1.99373 WP_002965019.1.99421 204722.BR1953 262698.BruAb1_1929 359391.BAB1_1954 430066.BAbS19_I18320 568815.BMI_I1975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]