SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62291011|ref|YP_222804.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62291011|ref|YP_222804.1|
Domain Number 1 Region: 23-259
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.18e-84
Family Phosphate binding protein-like 0.00000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62291011|ref|YP_222804.1|
Sequence length 259
Comment YaeC family lipoprotein [Brucella abortus bv. 1 str. 9-941]
Sequence
MRKLLVAATILAFCTAGSAFAKTLRAGVTPGPHAQIMEKVKEVAAKKGIEIEIQEFSDYV
MPNMALADGALEANCFQHKPYLDNQVADRGFEIVSVAETVNFPMAMYSRKLKTIAELADG
STIAIPNDPTNGGRALLVLADNGLIKLDSTKGLKVSPADVTENPKNLKFVELDAAQLPRS
LEDVDGAVINTNYALEAGLDPKAGALVREGEKAPYTNILVVRTADKDADWVKTLIESYHS
DEVKDFIAKTFKGSVSPAW
Download sequence
Identical sequences A0A0F6AT86 A0A0M1WCA2 A0A2K4NMX6 D7H0S1 Q2YQQ6 Q57A91
gi|189025225|ref|YP_001935993.1| WP_002965237.1.100443 WP_002965237.1.101965 WP_002965237.1.102082 WP_002965237.1.10322 WP_002965237.1.10630 WP_002965237.1.10893 WP_002965237.1.11620 WP_002965237.1.12041 WP_002965237.1.12241 WP_002965237.1.13460 WP_002965237.1.13826 WP_002965237.1.14542 WP_002965237.1.14633 WP_002965237.1.15077 WP_002965237.1.16975 WP_002965237.1.17378 WP_002965237.1.18034 WP_002965237.1.18635 WP_002965237.1.19641 WP_002965237.1.20012 WP_002965237.1.22583 WP_002965237.1.2337 WP_002965237.1.24196 WP_002965237.1.24428 WP_002965237.1.24655 WP_002965237.1.24726 WP_002965237.1.25101 WP_002965237.1.25382 WP_002965237.1.25729 WP_002965237.1.26599 WP_002965237.1.2778 WP_002965237.1.2839 WP_002965237.1.2874 WP_002965237.1.2877 WP_002965237.1.28889 WP_002965237.1.31239 WP_002965237.1.32337 WP_002965237.1.32492 WP_002965237.1.32731 WP_002965237.1.33220 WP_002965237.1.33599 WP_002965237.1.33753 WP_002965237.1.34353 WP_002965237.1.35056 WP_002965237.1.35970 WP_002965237.1.37797 WP_002965237.1.38353 WP_002965237.1.39021 WP_002965237.1.39039 WP_002965237.1.39963 WP_002965237.1.40407 WP_002965237.1.40624 WP_002965237.1.40649 WP_002965237.1.40871 WP_002965237.1.41044 WP_002965237.1.41311 WP_002965237.1.42103 WP_002965237.1.42427 WP_002965237.1.43597 WP_002965237.1.4428 WP_002965237.1.45559 WP_002965237.1.46182 WP_002965237.1.46432 WP_002965237.1.4727 WP_002965237.1.47558 WP_002965237.1.47610 WP_002965237.1.4847 WP_002965237.1.49640 WP_002965237.1.50051 WP_002965237.1.50053 WP_002965237.1.50282 WP_002965237.1.5052 WP_002965237.1.5236 WP_002965237.1.53128 WP_002965237.1.53481 WP_002965237.1.5394 WP_002965237.1.54440 WP_002965237.1.55440 WP_002965237.1.55684 WP_002965237.1.56334 WP_002965237.1.56952 WP_002965237.1.57925 WP_002965237.1.58525 WP_002965237.1.58539 WP_002965237.1.59086 WP_002965237.1.59515 WP_002965237.1.61325 WP_002965237.1.61536 WP_002965237.1.61811 WP_002965237.1.61997 WP_002965237.1.63730 WP_002965237.1.64124 WP_002965237.1.64853 WP_002965237.1.64905 WP_002965237.1.65131 WP_002965237.1.65454 WP_002965237.1.65625 WP_002965237.1.66260 WP_002965237.1.66810 WP_002965237.1.67893 WP_002965237.1.67996 WP_002965237.1.67997 WP_002965237.1.68913 WP_002965237.1.69451 WP_002965237.1.69829 WP_002965237.1.70322 WP_002965237.1.71194 WP_002965237.1.71689 WP_002965237.1.71846 WP_002965237.1.7206 WP_002965237.1.72916 WP_002965237.1.75458 WP_002965237.1.75766 WP_002965237.1.76350 WP_002965237.1.76433 WP_002965237.1.77321 WP_002965237.1.78109 WP_002965237.1.7984 WP_002965237.1.79963 WP_002965237.1.80266 WP_002965237.1.80476 WP_002965237.1.80697 WP_002965237.1.81617 WP_002965237.1.81822 WP_002965237.1.8224 WP_002965237.1.8278 WP_002965237.1.8307 WP_002965237.1.85322 WP_002965237.1.85769 WP_002965237.1.8657 WP_002965237.1.87522 WP_002965237.1.87603 WP_002965237.1.87867 WP_002965237.1.8788 WP_002965237.1.8878 WP_002965237.1.90689 WP_002965237.1.91123 WP_002965237.1.91338 WP_002965237.1.92518 WP_002965237.1.93454 WP_002965237.1.94126 WP_002965237.1.94555 WP_002965237.1.94775 WP_002965237.1.97511 WP_002965237.1.97741 WP_002965237.1.98076 WP_002965237.1.98455 WP_002965237.1.99221 WP_002965237.1.99373 WP_002965237.1.99421 262698.BruAb1_2148 359391.BAB1_2176 430066.BAbS19_I20370 gi|62291011|ref|YP_222804.1| gi|376272103|ref|YP_005150681.1| gi|82700922|ref|YP_415496.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]