SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62317047|ref|YP_222900.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62317047|ref|YP_222900.1|
Domain Number 1 Region: 24-244
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.15e-59
Family Phosphate binding protein-like 0.0000069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62317047|ref|YP_222900.1|
Sequence length 251
Comment ModeA, molybdenum ABC transporter periplasmic molybdenum-binding protein [Brucella abortus bv. 1 str. 9-941]
Sequence
MKKLIATFLITIAAGAASVAQAAEKVTVFAAASMKDMIEEAARQIKARDGTEVVASFASS
SALARQIEQGAPAQIFISADLDWMDYVEKAGLIDKASRKIIAGNALVIAAQKDTPKGDAR
ELLSAGRFAMGDPSNVPAGKYGKAALEKLDIWKEVEKNAVFTENVRVALRYVSLAEVKTA
IVYASDRVAAPELVEAYRFPADSHAPILYPAALLKKNESDAARTFLAFLESDAGQAIIKD
KGFVGAAEAAE
Download sequence
Identical sequences A0A0F6ATH1 A0A0M1WFM5 A0A2I7WU46 D7H5E0 Q2YIN7 Q579Z5
gi|83269041|ref|YP_418332.1| gi|62317047|ref|YP_222900.1| WP_002966490.1.100443 WP_002966490.1.101965 WP_002966490.1.102082 WP_002966490.1.10322 WP_002966490.1.10630 WP_002966490.1.10893 WP_002966490.1.11620 WP_002966490.1.12041 WP_002966490.1.12241 WP_002966490.1.13460 WP_002966490.1.13826 WP_002966490.1.14542 WP_002966490.1.14633 WP_002966490.1.15077 WP_002966490.1.16975 WP_002966490.1.17378 WP_002966490.1.18034 WP_002966490.1.19641 WP_002966490.1.20012 WP_002966490.1.22583 WP_002966490.1.2337 WP_002966490.1.24196 WP_002966490.1.24428 WP_002966490.1.24655 WP_002966490.1.24726 WP_002966490.1.25101 WP_002966490.1.25382 WP_002966490.1.25729 WP_002966490.1.26599 WP_002966490.1.2778 WP_002966490.1.2839 WP_002966490.1.2874 WP_002966490.1.2877 WP_002966490.1.28889 WP_002966490.1.31239 WP_002966490.1.32337 WP_002966490.1.32492 WP_002966490.1.32731 WP_002966490.1.33220 WP_002966490.1.33599 WP_002966490.1.33753 WP_002966490.1.34353 WP_002966490.1.35056 WP_002966490.1.35970 WP_002966490.1.38353 WP_002966490.1.39021 WP_002966490.1.39039 WP_002966490.1.39963 WP_002966490.1.40407 WP_002966490.1.40624 WP_002966490.1.40649 WP_002966490.1.40871 WP_002966490.1.41044 WP_002966490.1.41311 WP_002966490.1.42103 WP_002966490.1.42427 WP_002966490.1.43597 WP_002966490.1.4428 WP_002966490.1.45559 WP_002966490.1.46182 WP_002966490.1.46432 WP_002966490.1.4727 WP_002966490.1.47558 WP_002966490.1.47610 WP_002966490.1.4847 WP_002966490.1.49640 WP_002966490.1.50051 WP_002966490.1.50053 WP_002966490.1.50282 WP_002966490.1.5052 WP_002966490.1.5236 WP_002966490.1.53128 WP_002966490.1.53481 WP_002966490.1.5394 WP_002966490.1.54440 WP_002966490.1.55440 WP_002966490.1.55684 WP_002966490.1.56334 WP_002966490.1.56952 WP_002966490.1.57925 WP_002966490.1.58525 WP_002966490.1.58539 WP_002966490.1.59086 WP_002966490.1.59515 WP_002966490.1.61325 WP_002966490.1.61536 WP_002966490.1.61811 WP_002966490.1.61997 WP_002966490.1.63730 WP_002966490.1.64124 WP_002966490.1.64853 WP_002966490.1.64905 WP_002966490.1.65131 WP_002966490.1.65454 WP_002966490.1.65625 WP_002966490.1.66260 WP_002966490.1.66810 WP_002966490.1.67893 WP_002966490.1.67996 WP_002966490.1.67997 WP_002966490.1.68913 WP_002966490.1.69451 WP_002966490.1.69829 WP_002966490.1.70322 WP_002966490.1.71194 WP_002966490.1.71689 WP_002966490.1.71846 WP_002966490.1.7206 WP_002966490.1.72916 WP_002966490.1.75458 WP_002966490.1.75766 WP_002966490.1.76350 WP_002966490.1.76433 WP_002966490.1.77321 WP_002966490.1.78109 WP_002966490.1.7984 WP_002966490.1.79963 WP_002966490.1.80266 WP_002966490.1.80476 WP_002966490.1.80697 WP_002966490.1.81617 WP_002966490.1.81822 WP_002966490.1.8224 WP_002966490.1.8278 WP_002966490.1.8307 WP_002966490.1.85322 WP_002966490.1.85769 WP_002966490.1.8657 WP_002966490.1.87522 WP_002966490.1.87603 WP_002966490.1.87867 WP_002966490.1.8788 WP_002966490.1.8878 WP_002966490.1.90689 WP_002966490.1.91123 WP_002966490.1.91338 WP_002966490.1.92518 WP_002966490.1.93454 WP_002966490.1.94126 WP_002966490.1.94555 WP_002966490.1.94775 WP_002966490.1.97511 WP_002966490.1.97741 WP_002966490.1.98076 WP_002966490.1.98455 WP_002966490.1.99221 WP_002966490.1.99373 WP_002966490.1.99421 gi|376270634|ref|YP_005113679.1| 262698.BruAb2_0088 359391.BAB2_0087 430066.BAbS19_II00810 gi|189022313|ref|YP_001932054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]