SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62317215|ref|YP_223068.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62317215|ref|YP_223068.1|
Domain Number 1 Region: 41-277
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.44e-79
Family Phosphate binding protein-like 0.00000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62317215|ref|YP_223068.1|
Sequence length 278
Comment YaeC family lipoprotein [Brucella abortus bv. 1 str. 9-941]
Sequence
MSSVLSRYALTRRAGLKALLFTAAALTVGFASAPSHAEDKTIKVGIMGGEDEDVWKVVAE
EGKKHGLNIERITFNDYNQPNETLERKEIDANAFQHKPYLDEQIKQHGYKISVAGYTAVW
PIGIYSRKVKKLEELKDGATVGVPNDPTNEGRALRVLEEQGLIKLKPDAGILATPIDIVE
NPKKLEIKELDAGVVGRSIDDLDAAIVNNDWAAKAGLKKEDAIGWESKENNPYNNFIAVR
TDDLDQPWVKALVASFQNDAVKTELERAYKGTGIPAWN
Download sequence
Identical sequences A0A0F6ATX6 A0A0M1WG29 A0A2I7WUL6 C4IUR2 Q2YIV4 Q579H7
WP_002967209.1.100443 WP_002967209.1.102082 WP_002967209.1.10630 WP_002967209.1.11620 WP_002967209.1.12241 WP_002967209.1.13460 WP_002967209.1.13826 WP_002967209.1.14633 WP_002967209.1.16975 WP_002967209.1.19641 WP_002967209.1.20012 WP_002967209.1.22583 WP_002967209.1.24196 WP_002967209.1.24428 WP_002967209.1.24655 WP_002967209.1.25382 WP_002967209.1.26599 WP_002967209.1.2778 WP_002967209.1.2839 WP_002967209.1.2874 WP_002967209.1.31239 WP_002967209.1.32337 WP_002967209.1.33599 WP_002967209.1.33753 WP_002967209.1.35970 WP_002967209.1.39039 WP_002967209.1.39963 WP_002967209.1.40407 WP_002967209.1.40624 WP_002967209.1.40649 WP_002967209.1.40871 WP_002967209.1.41044 WP_002967209.1.42427 WP_002967209.1.43597 WP_002967209.1.4428 WP_002967209.1.45559 WP_002967209.1.46182 WP_002967209.1.46432 WP_002967209.1.47558 WP_002967209.1.47610 WP_002967209.1.50051 WP_002967209.1.50053 WP_002967209.1.50282 WP_002967209.1.5052 WP_002967209.1.5236 WP_002967209.1.53128 WP_002967209.1.53481 WP_002967209.1.5394 WP_002967209.1.54440 WP_002967209.1.55440 WP_002967209.1.55684 WP_002967209.1.56334 WP_002967209.1.56952 WP_002967209.1.57925 WP_002967209.1.58539 WP_002967209.1.59086 WP_002967209.1.61536 WP_002967209.1.61811 WP_002967209.1.61997 WP_002967209.1.63730 WP_002967209.1.64124 WP_002967209.1.64853 WP_002967209.1.64905 WP_002967209.1.65131 WP_002967209.1.65454 WP_002967209.1.66260 WP_002967209.1.66810 WP_002967209.1.67893 WP_002967209.1.67996 WP_002967209.1.67997 WP_002967209.1.69829 WP_002967209.1.70322 WP_002967209.1.71194 WP_002967209.1.71846 WP_002967209.1.72916 WP_002967209.1.75458 WP_002967209.1.76350 WP_002967209.1.76433 WP_002967209.1.77321 WP_002967209.1.78109 WP_002967209.1.7984 WP_002967209.1.79963 WP_002967209.1.80266 WP_002967209.1.80697 WP_002967209.1.81617 WP_002967209.1.8224 WP_002967209.1.8278 WP_002967209.1.8307 WP_002967209.1.8657 WP_002967209.1.87603 WP_002967209.1.87867 WP_002967209.1.8878 WP_002967209.1.90689 WP_002967209.1.91123 WP_002967209.1.91338 WP_002967209.1.92518 WP_002967209.1.93454 WP_002967209.1.94126 WP_002967209.1.94775 WP_002967209.1.97511 WP_002967209.1.97741 WP_002967209.1.98076 WP_002967209.1.98455 WP_002967209.1.99373 WP_002967209.1.99421 gi|376270826|ref|YP_005113871.1| 262698.BruAb2_0273 359391.BAB2_0275 430066.BAbS19_II02620 gi|189022478|ref|YP_001932219.1| gi|62317215|ref|YP_223068.1| gi|83269197|ref|YP_418488.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]