SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62317356|ref|YP_223209.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62317356|ref|YP_223209.1|
Domain Number 1 Region: 35-343
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.25e-26
Family Phosphate binding protein-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62317356|ref|YP_223209.1|
Sequence length 393
Comment ABC transporter substrate-binding protein [Brucella abortus bv. 1 str. 9-941]
Sequence
MRLTRRQALGGMAALAAFPASRVWAQTKPAMPASPVTLNIVDVAGNLALTQPAFEAYAKA
NPDKVSKITFTKAPAPELPGKLKAQQAANRLDIDVVLTGTDALSAGHELGLWVKLLPEYS
TSLPDLKTLYQEPAWRMQEAQGKQHGLAIVYYPSGPLLEYMPDKVKTVPRNLDELLVWAK
ENPNKFLYARPANSGPGRTFLMGLPYMLGDADPKDPMKSWDKTWAYLKELHKYIEYYPTG
TGALMKELGEGTRYMTVTTTGWDINPRVLGVVPKEAAVSKLDGFHWVADAQFMAVPKGIG
DDKLAVILDLMNYMLTPEAQAVTYDQGYFYPGPVVKDVPITMAPQSSQDAIAEFGRAEYA
DWIANNPIELPLEPAAMVAAFRRWDEDVASQPK
Download sequence
Identical sequences A0A0F6AU97 A0A0M1WGW4 A0A2K4NP48 C4IV44 D7H6L7 Q2YJ40 Q578T6
WP_002967249.1.100443 WP_002967249.1.101965 WP_002967249.1.102082 WP_002967249.1.10322 WP_002967249.1.10630 WP_002967249.1.10893 WP_002967249.1.11620 WP_002967249.1.12041 WP_002967249.1.12241 WP_002967249.1.13460 WP_002967249.1.13826 WP_002967249.1.14542 WP_002967249.1.14633 WP_002967249.1.15077 WP_002967249.1.16975 WP_002967249.1.17378 WP_002967249.1.18034 WP_002967249.1.18635 WP_002967249.1.19641 WP_002967249.1.20012 WP_002967249.1.20317 WP_002967249.1.22583 WP_002967249.1.2337 WP_002967249.1.24196 WP_002967249.1.24428 WP_002967249.1.24655 WP_002967249.1.24726 WP_002967249.1.25101 WP_002967249.1.25382 WP_002967249.1.25729 WP_002967249.1.26599 WP_002967249.1.2778 WP_002967249.1.2839 WP_002967249.1.2874 WP_002967249.1.28889 WP_002967249.1.31094 WP_002967249.1.31106 WP_002967249.1.31239 WP_002967249.1.32337 WP_002967249.1.32492 WP_002967249.1.32731 WP_002967249.1.33599 WP_002967249.1.33753 WP_002967249.1.34353 WP_002967249.1.35056 WP_002967249.1.35970 WP_002967249.1.37797 WP_002967249.1.38353 WP_002967249.1.39021 WP_002967249.1.39039 WP_002967249.1.39963 WP_002967249.1.40407 WP_002967249.1.40624 WP_002967249.1.40649 WP_002967249.1.40871 WP_002967249.1.41044 WP_002967249.1.41311 WP_002967249.1.41835 WP_002967249.1.42103 WP_002967249.1.42427 WP_002967249.1.43597 WP_002967249.1.4428 WP_002967249.1.45559 WP_002967249.1.46182 WP_002967249.1.46432 WP_002967249.1.4727 WP_002967249.1.47558 WP_002967249.1.47610 WP_002967249.1.4847 WP_002967249.1.49640 WP_002967249.1.49953 WP_002967249.1.50051 WP_002967249.1.50053 WP_002967249.1.50282 WP_002967249.1.5052 WP_002967249.1.5236 WP_002967249.1.53128 WP_002967249.1.53481 WP_002967249.1.5394 WP_002967249.1.54440 WP_002967249.1.54779 WP_002967249.1.55440 WP_002967249.1.55684 WP_002967249.1.56334 WP_002967249.1.56683 WP_002967249.1.56952 WP_002967249.1.57925 WP_002967249.1.58525 WP_002967249.1.58539 WP_002967249.1.59086 WP_002967249.1.61325 WP_002967249.1.61536 WP_002967249.1.61811 WP_002967249.1.61997 WP_002967249.1.63730 WP_002967249.1.64124 WP_002967249.1.64853 WP_002967249.1.64883 WP_002967249.1.64905 WP_002967249.1.65131 WP_002967249.1.65454 WP_002967249.1.6555 WP_002967249.1.65625 WP_002967249.1.66078 WP_002967249.1.66260 WP_002967249.1.66810 WP_002967249.1.67893 WP_002967249.1.67996 WP_002967249.1.67997 WP_002967249.1.68913 WP_002967249.1.69451 WP_002967249.1.69829 WP_002967249.1.70322 WP_002967249.1.71194 WP_002967249.1.71689 WP_002967249.1.71846 WP_002967249.1.7206 WP_002967249.1.72916 WP_002967249.1.75458 WP_002967249.1.75766 WP_002967249.1.76350 WP_002967249.1.76433 WP_002967249.1.77321 WP_002967249.1.78109 WP_002967249.1.78821 WP_002967249.1.7984 WP_002967249.1.79963 WP_002967249.1.80266 WP_002967249.1.80476 WP_002967249.1.80697 WP_002967249.1.81617 WP_002967249.1.8224 WP_002967249.1.8278 WP_002967249.1.8307 WP_002967249.1.85322 WP_002967249.1.85769 WP_002967249.1.8657 WP_002967249.1.87522 WP_002967249.1.87603 WP_002967249.1.87867 WP_002967249.1.8788 WP_002967249.1.8878 WP_002967249.1.90689 WP_002967249.1.91123 WP_002967249.1.91338 WP_002967249.1.92518 WP_002967249.1.93454 WP_002967249.1.93795 WP_002967249.1.94126 WP_002967249.1.94555 WP_002967249.1.94775 WP_002967249.1.97511 WP_002967249.1.97741 WP_002967249.1.98076 WP_002967249.1.98455 WP_002967249.1.99221 WP_002967249.1.99373 WP_002967249.1.99421 gi|83269333|ref|YP_418624.1| 262698.BruAb2_0422 359391.BAB2_0427 430066.BAbS19_II04020 NYSGRC-SEC-62317356 gi|62317356|ref|YP_223209.1| gi|189022608|ref|YP_001932349.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]