SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62317421|ref|YP_223274.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62317421|ref|YP_223274.1|
Domain Number 1 Region: 23-287
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.17e-79
Family Phosphate binding protein-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|62317421|ref|YP_223274.1|
Sequence length 288
Comment glycine betaine/L-proline ABC transporter periplasmic glycine betaine-binding protein [Brucella abortus bv. 1 str. 9-941]
Sequence
MLGKLTRFGLAAVVAGTMTMGAAFAQDGKTVKIGWAPWSDAEFVTKLARKLIEDNLGQKV
ELVQTDVAPLYQGVSRGDIDAMMMAWLPETHADYYKRVEGKVENLGPLYEGAKLGWIVPD
YIPESEVSSIEDLKKPEVREKLKGEIQGIDPGAGLTRLSQEAIKKYGLDYKLNISSEAAM
LTTVDRANRSEGWFVATSWSPHWMFGKYKLRYIADPKGALGGAEHIDAVARKGFKEDDPK
VAALLAKMSIPINELEAAMFDAQETSYEKAVDKYIADHPDRIKEWLSQ
Download sequence
Identical sequences A0A0M1WH31 A0A2I7WV50 Q2YKZ2 Q578M1
262698.BruAb2_0494 359391.BAB2_0502 gi|62317421|ref|YP_223274.1| gi|376271054|ref|YP_005114099.1| WP_002969318.1.100443 WP_002969318.1.102082 WP_002969318.1.10322 WP_002969318.1.10630 WP_002969318.1.11620 WP_002969318.1.12041 WP_002969318.1.12241 WP_002969318.1.13460 WP_002969318.1.13826 WP_002969318.1.14633 WP_002969318.1.15077 WP_002969318.1.16975 WP_002969318.1.18635 WP_002969318.1.19641 WP_002969318.1.20012 WP_002969318.1.22583 WP_002969318.1.2337 WP_002969318.1.24196 WP_002969318.1.24428 WP_002969318.1.24655 WP_002969318.1.24726 WP_002969318.1.25382 WP_002969318.1.26599 WP_002969318.1.2778 WP_002969318.1.2839 WP_002969318.1.2874 WP_002969318.1.28889 WP_002969318.1.31239 WP_002969318.1.32337 WP_002969318.1.32492 WP_002969318.1.32731 WP_002969318.1.33599 WP_002969318.1.33753 WP_002969318.1.35056 WP_002969318.1.35970 WP_002969318.1.37797 WP_002969318.1.38353 WP_002969318.1.39039 WP_002969318.1.39963 WP_002969318.1.40407 WP_002969318.1.40624 WP_002969318.1.40649 WP_002969318.1.40871 WP_002969318.1.41044 WP_002969318.1.41311 WP_002969318.1.42103 WP_002969318.1.42427 WP_002969318.1.43597 WP_002969318.1.4428 WP_002969318.1.45559 WP_002969318.1.46182 WP_002969318.1.46432 WP_002969318.1.4727 WP_002969318.1.47558 WP_002969318.1.47610 WP_002969318.1.50051 WP_002969318.1.50053 WP_002969318.1.50282 WP_002969318.1.5052 WP_002969318.1.5236 WP_002969318.1.53128 WP_002969318.1.53481 WP_002969318.1.5394 WP_002969318.1.54440 WP_002969318.1.55440 WP_002969318.1.55684 WP_002969318.1.56334 WP_002969318.1.56952 WP_002969318.1.57925 WP_002969318.1.58539 WP_002969318.1.59086 WP_002969318.1.61325 WP_002969318.1.61536 WP_002969318.1.61811 WP_002969318.1.61997 WP_002969318.1.63730 WP_002969318.1.64124 WP_002969318.1.64853 WP_002969318.1.64905 WP_002969318.1.65131 WP_002969318.1.65454 WP_002969318.1.66260 WP_002969318.1.66810 WP_002969318.1.67893 WP_002969318.1.67996 WP_002969318.1.67997 WP_002969318.1.68913 WP_002969318.1.69829 WP_002969318.1.70322 WP_002969318.1.71194 WP_002969318.1.71689 WP_002969318.1.71846 WP_002969318.1.7206 WP_002969318.1.72916 WP_002969318.1.75458 WP_002969318.1.76350 WP_002969318.1.76433 WP_002969318.1.77321 WP_002969318.1.78109 WP_002969318.1.7984 WP_002969318.1.79963 WP_002969318.1.80266 WP_002969318.1.80476 WP_002969318.1.80697 WP_002969318.1.81617 WP_002969318.1.81822 WP_002969318.1.8224 WP_002969318.1.8278 WP_002969318.1.8307 WP_002969318.1.85769 WP_002969318.1.8657 WP_002969318.1.87522 WP_002969318.1.87603 WP_002969318.1.87867 WP_002969318.1.8788 WP_002969318.1.8878 WP_002969318.1.90689 WP_002969318.1.91123 WP_002969318.1.91338 WP_002969318.1.92518 WP_002969318.1.93454 WP_002969318.1.94126 WP_002969318.1.94555 WP_002969318.1.94775 WP_002969318.1.97511 WP_002969318.1.97741 WP_002969318.1.98076 WP_002969318.1.98455 WP_002969318.1.99373 WP_002969318.1.99421 gi|83269401|ref|YP_418692.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]