SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62317463|ref|YP_223316.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62317463|ref|YP_223316.1|
Domain Number 1 Region: 30-419
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.63e-61
Family Phosphate binding protein-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|62317463|ref|YP_223316.1|
Sequence length 421
Comment sugar ABC transporter periplasmic sugar-binding protein [Brucella abortus bv. 1 str. 9-941]
Sequence
MHKLLKLAAMGTAACALLAGMAPVANAQEKQNVEVLHWWTSGGEASALEVLKKDLESKGI
SWTDMPVAGGGGTEAMTVLRARVTAGNAPTAVQMLGFDIRDWAEQGALGNLDTVASKEGW
EKVIPAPLQEFAKYDGHWIAAPVNIHSTNWMWINKAALDKAGGKEPTNWDELIALLDNFK
AQGITPIAHGGQPWQDATIFDAVVLSFGPDFYKKAFIDLDPEALGSDTMKQAFDRMSKLR
TYVDDNFSGRDWNLASAMVIEGKAGVQFMGDWAKGEFLKAGKKPGEDFVCMRYPGTQGAV
TFNSDMFAMFKVSEDKVPAQLEMASAIESPAFQSAFNVVKGSAPARTDVPDTAFDACGKK
AIADVKEANSKGTLLGSMAHGYANPAAVKNAIYDVVTRQFNGQLSSEDAVKELVAAVEAA
K
Download sequence
Identical sequences A0A0F6AUK0 A0A0M1WH70 A0A1M4LFW3 A0A1P8S9K1 A0A2I7WV80 A9WYY9 C7LIH0 C9V5F6 D1D110 O06875 Q2YKU9
262698.BruAb2_0537 359391.BAB2_0547 430066.BAbS19_II05150 470137.BSUIS_B0677 568815.BMI_II687 gi|376271100|ref|YP_005114145.1| gi|83269444|ref|YP_418735.1| gi|256015461|ref|YP_003105470.1| gi|163844822|ref|YP_001622477.1| WP_002967274.1.100204 WP_002967274.1.100443 WP_002967274.1.102082 WP_002967274.1.10630 WP_002967274.1.1158 WP_002967274.1.11620 WP_002967274.1.12241 WP_002967274.1.13460 WP_002967274.1.13576 WP_002967274.1.13826 WP_002967274.1.14633 WP_002967274.1.16975 WP_002967274.1.17733 WP_002967274.1.19508 WP_002967274.1.19641 WP_002967274.1.20012 WP_002967274.1.2214 WP_002967274.1.22583 WP_002967274.1.24196 WP_002967274.1.24428 WP_002967274.1.24496 WP_002967274.1.24655 WP_002967274.1.25382 WP_002967274.1.26599 WP_002967274.1.2778 WP_002967274.1.2839 WP_002967274.1.2874 WP_002967274.1.29336 WP_002967274.1.31094 WP_002967274.1.31106 WP_002967274.1.31239 WP_002967274.1.32337 WP_002967274.1.33599 WP_002967274.1.33753 WP_002967274.1.35970 WP_002967274.1.39039 WP_002967274.1.39963 WP_002967274.1.40407 WP_002967274.1.40624 WP_002967274.1.40649 WP_002967274.1.40871 WP_002967274.1.41044 WP_002967274.1.41835 WP_002967274.1.41893 WP_002967274.1.4207 WP_002967274.1.42427 WP_002967274.1.43597 WP_002967274.1.4428 WP_002967274.1.45546 WP_002967274.1.45559 WP_002967274.1.46182 WP_002967274.1.46432 WP_002967274.1.47558 WP_002967274.1.47610 WP_002967274.1.48744 WP_002967274.1.50051 WP_002967274.1.50053 WP_002967274.1.50282 WP_002967274.1.5052 WP_002967274.1.5236 WP_002967274.1.53128 WP_002967274.1.53481 WP_002967274.1.5394 WP_002967274.1.54440 WP_002967274.1.54776 WP_002967274.1.54779 WP_002967274.1.55440 WP_002967274.1.55684 WP_002967274.1.56334 WP_002967274.1.56683 WP_002967274.1.57925 WP_002967274.1.58539 WP_002967274.1.59086 WP_002967274.1.61536 WP_002967274.1.61811 WP_002967274.1.61997 WP_002967274.1.63730 WP_002967274.1.64013 WP_002967274.1.64124 WP_002967274.1.64853 WP_002967274.1.64883 WP_002967274.1.64905 WP_002967274.1.65131 WP_002967274.1.65454 WP_002967274.1.6555 WP_002967274.1.66260 WP_002967274.1.66810 WP_002967274.1.67402 WP_002967274.1.67893 WP_002967274.1.67996 WP_002967274.1.67997 WP_002967274.1.69829 WP_002967274.1.70322 WP_002967274.1.71077 WP_002967274.1.71194 WP_002967274.1.71846 WP_002967274.1.72012 WP_002967274.1.72916 WP_002967274.1.74005 WP_002967274.1.75434 WP_002967274.1.75458 WP_002967274.1.76350 WP_002967274.1.76433 WP_002967274.1.77165 WP_002967274.1.77321 WP_002967274.1.77683 WP_002967274.1.77899 WP_002967274.1.78109 WP_002967274.1.78821 WP_002967274.1.7984 WP_002967274.1.79963 WP_002967274.1.80266 WP_002967274.1.80697 WP_002967274.1.81617 WP_002967274.1.82113 WP_002967274.1.8224 WP_002967274.1.82595 WP_002967274.1.8278 WP_002967274.1.8307 WP_002967274.1.83513 WP_002967274.1.84512 WP_002967274.1.8657 WP_002967274.1.87603 WP_002967274.1.87867 WP_002967274.1.88404 WP_002967274.1.8878 WP_002967274.1.90420 WP_002967274.1.90689 WP_002967274.1.91123 WP_002967274.1.91338 WP_002967274.1.91710 WP_002967274.1.92518 WP_002967274.1.93454 WP_002967274.1.93795 WP_002967274.1.94126 WP_002967274.1.94770 WP_002967274.1.94775 WP_002967274.1.97511 WP_002967274.1.97741 WP_002967274.1.98076 WP_002967274.1.98455 WP_002967274.1.98704 WP_002967274.1.99373 WP_002967274.1.99421 gi|189022717|ref|YP_001932458.1| gi|62317463|ref|YP_223316.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]