SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62317515|ref|YP_223368.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62317515|ref|YP_223368.1|
Domain Number 1 Region: 1-256
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.44e-74
Family Phosphate binding protein-like 0.0000078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62317515|ref|YP_223368.1|
Sequence length 257
Comment amino acid ABC transporter substrate-binding protein [Brucella abortus bv. 1 str. 9-941]
Sequence
MLKSLVLAGLASVVLTVSVQAPVQAKEWKEIRIASEGAYPPFNYMSPDGKLVGFDLDIAN
ALCEAMEAKCTIVANDWDGMIPGLQANKFDAVIASMAITDERKKQVAFTDRYYTTPLAVV
VPKDSDIVSLEPSAFAGKMVGAQAGTTQGNYADDVYGKAGADVKLYPTADEANADLESGR
LDALAADKFIAADWLKKQGADCCKFLGDIPGSETQIAVALRQGDDDLREQFNAAIKKIRE
NGTYETIRKKYFDFDIY
Download sequence
Identical sequences A0A0F6AUQ3 A0A1G4EZ74 A0A1M4LG30 A0A1P8S9E8 A0A2K4NPJ7 C7LIB7 D7H731 E2PKE6 Q2YKP5 Q578C7
gi|256015408|ref|YP_003105417.1| WP_002971234.1.100018 WP_002971234.1.100443 WP_002971234.1.101965 WP_002971234.1.102082 WP_002971234.1.10322 WP_002971234.1.10630 WP_002971234.1.10893 WP_002971234.1.11306 WP_002971234.1.11620 WP_002971234.1.12041 WP_002971234.1.12241 WP_002971234.1.13460 WP_002971234.1.13826 WP_002971234.1.14542 WP_002971234.1.14633 WP_002971234.1.15077 WP_002971234.1.16733 WP_002971234.1.16975 WP_002971234.1.17378 WP_002971234.1.18034 WP_002971234.1.18635 WP_002971234.1.19508 WP_002971234.1.19641 WP_002971234.1.20012 WP_002971234.1.20317 WP_002971234.1.21149 WP_002971234.1.22583 WP_002971234.1.2337 WP_002971234.1.24196 WP_002971234.1.24428 WP_002971234.1.24655 WP_002971234.1.24726 WP_002971234.1.25101 WP_002971234.1.25382 WP_002971234.1.25561 WP_002971234.1.25729 WP_002971234.1.26599 WP_002971234.1.27564 WP_002971234.1.2778 WP_002971234.1.2839 WP_002971234.1.2874 WP_002971234.1.2877 WP_002971234.1.28889 WP_002971234.1.29336 WP_002971234.1.31094 WP_002971234.1.31106 WP_002971234.1.31239 WP_002971234.1.32337 WP_002971234.1.32492 WP_002971234.1.32731 WP_002971234.1.33220 WP_002971234.1.33599 WP_002971234.1.33753 WP_002971234.1.34353 WP_002971234.1.35056 WP_002971234.1.35970 WP_002971234.1.3681 WP_002971234.1.37797 WP_002971234.1.38353 WP_002971234.1.38925 WP_002971234.1.39021 WP_002971234.1.39039 WP_002971234.1.39963 WP_002971234.1.40138 WP_002971234.1.40407 WP_002971234.1.40624 WP_002971234.1.40649 WP_002971234.1.40871 WP_002971234.1.41044 WP_002971234.1.41311 WP_002971234.1.41835 WP_002971234.1.41950 WP_002971234.1.4207 WP_002971234.1.42103 WP_002971234.1.42427 WP_002971234.1.43359 WP_002971234.1.43583 WP_002971234.1.43597 WP_002971234.1.4428 WP_002971234.1.44793 WP_002971234.1.44989 WP_002971234.1.45559 WP_002971234.1.46182 WP_002971234.1.46432 WP_002971234.1.4727 WP_002971234.1.47558 WP_002971234.1.47610 WP_002971234.1.4847 WP_002971234.1.49640 WP_002971234.1.49953 WP_002971234.1.50051 WP_002971234.1.50053 WP_002971234.1.50282 WP_002971234.1.5052 WP_002971234.1.5236 WP_002971234.1.53128 WP_002971234.1.53481 WP_002971234.1.5394 WP_002971234.1.54440 WP_002971234.1.54776 WP_002971234.1.54779 WP_002971234.1.55440 WP_002971234.1.55684 WP_002971234.1.56334 WP_002971234.1.56683 WP_002971234.1.56952 WP_002971234.1.57925 WP_002971234.1.58525 WP_002971234.1.58539 WP_002971234.1.59086 WP_002971234.1.59515 WP_002971234.1.59985 WP_002971234.1.61325 WP_002971234.1.61536 WP_002971234.1.61811 WP_002971234.1.61997 WP_002971234.1.63730 WP_002971234.1.64013 WP_002971234.1.64124 WP_002971234.1.64853 WP_002971234.1.64883 WP_002971234.1.64905 WP_002971234.1.65131 WP_002971234.1.65454 WP_002971234.1.6555 WP_002971234.1.65625 WP_002971234.1.66260 WP_002971234.1.66810 WP_002971234.1.67893 WP_002971234.1.67996 WP_002971234.1.67997 WP_002971234.1.68913 WP_002971234.1.69451 WP_002971234.1.69829 WP_002971234.1.70296 WP_002971234.1.70322 WP_002971234.1.71077 WP_002971234.1.71194 WP_002971234.1.71689 WP_002971234.1.71846 WP_002971234.1.72012 WP_002971234.1.7206 WP_002971234.1.72916 WP_002971234.1.7410 WP_002971234.1.75434 WP_002971234.1.75458 WP_002971234.1.75766 WP_002971234.1.76350 WP_002971234.1.76433 WP_002971234.1.77321 WP_002971234.1.77899 WP_002971234.1.78109 WP_002971234.1.78821 WP_002971234.1.7984 WP_002971234.1.79963 WP_002971234.1.8012 WP_002971234.1.80266 WP_002971234.1.80476 WP_002971234.1.80697 WP_002971234.1.81617 WP_002971234.1.81822 WP_002971234.1.82113 WP_002971234.1.8224 WP_002971234.1.82595 WP_002971234.1.8278 WP_002971234.1.8307 WP_002971234.1.85322 WP_002971234.1.85769 WP_002971234.1.8657 WP_002971234.1.87522 WP_002971234.1.87603 WP_002971234.1.87867 WP_002971234.1.8788 WP_002971234.1.88404 WP_002971234.1.8878 WP_002971234.1.90689 WP_002971234.1.91123 WP_002971234.1.91338 WP_002971234.1.91710 WP_002971234.1.92518 WP_002971234.1.9303 WP_002971234.1.93230 WP_002971234.1.93454 WP_002971234.1.93795 WP_002971234.1.94126 WP_002971234.1.94555 WP_002971234.1.94775 WP_002971234.1.97511 WP_002971234.1.97741 WP_002971234.1.98076 WP_002971234.1.98455 WP_002971234.1.99221 WP_002971234.1.99373 WP_002971234.1.99421 262698.BruAb2_0594 359391.BAB2_0611 430066.BAbS19_II05710 568815.BMI_II629 gi|83269498|ref|YP_418789.1| gi|340792416|ref|YP_004757880.1| gi|189022771|ref|YP_001932512.1| gi|62317515|ref|YP_223368.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]