SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62317516|ref|YP_223369.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62317516|ref|YP_223369.1|
Domain Number 1 Region: 1-252
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.01e-73
Family Phosphate binding protein-like 0.00000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|62317516|ref|YP_223369.1|
Sequence length 253
Comment amino acid ABC transporter substrate-binding protein [Brucella abortus bv. 1 str. 9-941]
Sequence
MLKAIVFAGIASVIAVLPAQAREWKEIRIATEGAYPPFNFVASDGSLQGLDVDIAKALCK
AMDAKCTIVANDWDGMIPGLKSNKFDAVIASMSVTEERKKEVAFTDKYYSTPLSVAVPKD
SDITSVAPESFKGKTVGAQGSTTQGNYAEDVYGKAGAEVKLYPTADEANADLKSGRLDAV
VSDKFPISDWIKGDGADCCKLIGDIPGTQTDTAVALRLGDDDLREQFNAAIKKIREDGTY
ATIVKKYFDFDIY
Download sequence
Identical sequences A0A0F6AUQ4 A0A0H3AU63 A0A0H3GFD2 A0A0M1WI01 A0A1G4F4E7 A0A1P8S955 A0A1Z1ZRD8 A0A2D2BTS9 A0A2I7WVC3 A9MBR8 A9WYU7 C7LIB6 D6LRX4 D7H732 E2PKE5 N8LNU5 Q2YKP4 Q578C6
gi|189022772|ref|YP_001932513.1| gi|148558167|ref|YP_001257613.1| gi|376278596|ref|YP_005108629.1| gi|163844780|ref|YP_001622435.1| gi|62317516|ref|YP_223369.1| gi|161620690|ref|YP_001594576.1| gi|376276673|ref|YP_005152734.1| WP_002966007.1.100204 WP_002966007.1.100443 WP_002966007.1.101150 WP_002966007.1.101247 WP_002966007.1.102082 WP_002966007.1.10307 WP_002966007.1.10322 WP_002966007.1.10630 WP_002966007.1.10893 WP_002966007.1.11306 WP_002966007.1.1158 WP_002966007.1.11620 WP_002966007.1.11769 WP_002966007.1.12041 WP_002966007.1.12241 WP_002966007.1.13020 WP_002966007.1.13460 WP_002966007.1.13576 WP_002966007.1.13592 WP_002966007.1.13826 WP_002966007.1.14507 WP_002966007.1.14542 WP_002966007.1.14633 WP_002966007.1.15077 WP_002966007.1.15325 WP_002966007.1.16975 WP_002966007.1.17378 WP_002966007.1.17733 WP_002966007.1.1800 WP_002966007.1.18034 WP_002966007.1.19645 WP_002966007.1.20012 WP_002966007.1.20827 WP_002966007.1.2214 WP_002966007.1.22340 WP_002966007.1.22583 WP_002966007.1.2337 WP_002966007.1.23458 WP_002966007.1.24196 WP_002966007.1.24428 WP_002966007.1.24496 WP_002966007.1.24655 WP_002966007.1.24726 WP_002966007.1.2483 WP_002966007.1.25101 WP_002966007.1.25382 WP_002966007.1.25729 WP_002966007.1.26599 WP_002966007.1.27052 WP_002966007.1.2778 WP_002966007.1.2839 WP_002966007.1.2874 WP_002966007.1.2877 WP_002966007.1.28889 WP_002966007.1.29336 WP_002966007.1.31239 WP_002966007.1.31463 WP_002966007.1.32337 WP_002966007.1.32492 WP_002966007.1.32731 WP_002966007.1.33220 WP_002966007.1.33599 WP_002966007.1.33753 WP_002966007.1.3390 WP_002966007.1.33907 WP_002966007.1.34353 WP_002966007.1.35056 WP_002966007.1.35970 WP_002966007.1.38343 WP_002966007.1.38353 WP_002966007.1.38790 WP_002966007.1.39021 WP_002966007.1.39039 WP_002966007.1.39963 WP_002966007.1.40407 WP_002966007.1.40624 WP_002966007.1.40649 WP_002966007.1.408 WP_002966007.1.40871 WP_002966007.1.41044 WP_002966007.1.41311 WP_002966007.1.41893 WP_002966007.1.41941 WP_002966007.1.42103 WP_002966007.1.42427 WP_002966007.1.43006 WP_002966007.1.43689 WP_002966007.1.43928 WP_002966007.1.4428 WP_002966007.1.44949 WP_002966007.1.45546 WP_002966007.1.45559 WP_002966007.1.46182 WP_002966007.1.46432 WP_002966007.1.4727 WP_002966007.1.47545 WP_002966007.1.47558 WP_002966007.1.47610 WP_002966007.1.47843 WP_002966007.1.4847 WP_002966007.1.48727 WP_002966007.1.48948 WP_002966007.1.49427 WP_002966007.1.49542 WP_002966007.1.49640 WP_002966007.1.49753 WP_002966007.1.49942 WP_002966007.1.50051 WP_002966007.1.50053 WP_002966007.1.50282 WP_002966007.1.5052 WP_002966007.1.50952 WP_002966007.1.52027 WP_002966007.1.5236 WP_002966007.1.53128 WP_002966007.1.53481 WP_002966007.1.53843 WP_002966007.1.5394 WP_002966007.1.54440 WP_002966007.1.55440 WP_002966007.1.55684 WP_002966007.1.56313 WP_002966007.1.56334 WP_002966007.1.56947 WP_002966007.1.56952 WP_002966007.1.57564 WP_002966007.1.57925 WP_002966007.1.58260 WP_002966007.1.58525 WP_002966007.1.58539 WP_002966007.1.58868 WP_002966007.1.59086 WP_002966007.1.59091 WP_002966007.1.59515 WP_002966007.1.5971 WP_002966007.1.60631 WP_002966007.1.61325 WP_002966007.1.61536 WP_002966007.1.61997 WP_002966007.1.62592 WP_002966007.1.62872 WP_002966007.1.63628 WP_002966007.1.63730 WP_002966007.1.63732 WP_002966007.1.64124 WP_002966007.1.64849 WP_002966007.1.64853 WP_002966007.1.64905 WP_002966007.1.65131 WP_002966007.1.65299 WP_002966007.1.65454 WP_002966007.1.65625 WP_002966007.1.65651 WP_002966007.1.66260 WP_002966007.1.66340 WP_002966007.1.66810 WP_002966007.1.67402 WP_002966007.1.67893 WP_002966007.1.67996 WP_002966007.1.67997 WP_002966007.1.68488 WP_002966007.1.68913 WP_002966007.1.69829 WP_002966007.1.70322 WP_002966007.1.71002 WP_002966007.1.71689 WP_002966007.1.71846 WP_002966007.1.7206 WP_002966007.1.72533 WP_002966007.1.72916 WP_002966007.1.74005 WP_002966007.1.7410 WP_002966007.1.75458 WP_002966007.1.75766 WP_002966007.1.76350 WP_002966007.1.76433 WP_002966007.1.77165 WP_002966007.1.77321 WP_002966007.1.77683 WP_002966007.1.78109 WP_002966007.1.78225 WP_002966007.1.78716 WP_002966007.1.7984 WP_002966007.1.79963 WP_002966007.1.80266 WP_002966007.1.80365 WP_002966007.1.80476 WP_002966007.1.80697 WP_002966007.1.81027 WP_002966007.1.81617 WP_002966007.1.81822 WP_002966007.1.8223 WP_002966007.1.8224 WP_002966007.1.82448 WP_002966007.1.82565 WP_002966007.1.8307 WP_002966007.1.83161 WP_002966007.1.84207 WP_002966007.1.84512 WP_002966007.1.84540 WP_002966007.1.85721 WP_002966007.1.85769 WP_002966007.1.8657 WP_002966007.1.86923 WP_002966007.1.87222 WP_002966007.1.87522 WP_002966007.1.87603 WP_002966007.1.87867 WP_002966007.1.8788 WP_002966007.1.87893 WP_002966007.1.88404 WP_002966007.1.8878 WP_002966007.1.90420 WP_002966007.1.90689 WP_002966007.1.91123 WP_002966007.1.91338 WP_002966007.1.9163 WP_002966007.1.91768 WP_002966007.1.91958 WP_002966007.1.92518 WP_002966007.1.93367 WP_002966007.1.93454 WP_002966007.1.94126 WP_002966007.1.94513 WP_002966007.1.94555 WP_002966007.1.94648 WP_002966007.1.94770 WP_002966007.1.94775 WP_002966007.1.97240 WP_002966007.1.97511 WP_002966007.1.97741 WP_002966007.1.98076 WP_002966007.1.98362 WP_002966007.1.98455 WP_002966007.1.98704 WP_002966007.1.99221 WP_002966007.1.99373 WP_002966007.1.99421 gi|23500375|ref|NP_699815.1| gi|376271156|ref|YP_005114201.1| 204722.BRA0631 262698.BruAb2_0595 359391.BAB2_0612 430066.BAbS19_II05720 444178.BOV_A0593 470137.BSUIS_B0627 483179.BCAN_B0631 568815.BMI_II628 gi|256015407|ref|YP_003105416.1| gi|23500375|ref|NP_699815.1| gi|83269499|ref|YP_418790.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]