SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62317663|ref|YP_223516.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62317663|ref|YP_223516.1|
Domain Number 1 Region: 35-255
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.26e-27
Family Phosphate binding protein-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|62317663|ref|YP_223516.1|
Sequence length 340
Comment ABC transporter substrate-binding protein [Brucella abortus bv. 1 str. 9-941]
Sequence
MKFSLNRRQALLGMGAAGAAVAFGFPARAATRNLAVLHLASHAPSFIAHERGYFKDAGLD
IELKFFEAAQPSAVAIASGDADFGVTAMSGGLISLAQKGAVKVIGGALIEEKGVVGAIIL
ASNKAYDAGLTDPSRLAGKTFGITTAGSSFHFMAHKIAQANNIDLKQIQLRPLQKLGAVV
GALSSGQIDAWAIQPNIAKKLIREGAARQIGLVADYAPNYQVTTAFTSTRNATDERALTE
AFVKAYSRAIDDYNAAFVDNKTDDAERDALARIVHKYVESDSPFDTARQNLIDGAMRINP
GLALALDSCVEQLDWFKSEGMVKDSITNEQLFDTSYVKTI
Download sequence
Identical sequences A0A0F6AV30 A0A0M1WHT6 A0A2K4NQ28 C7LHW0 Q2YK97 Q577M9
262698.BruAb2_0753 359391.BAB2_0767 430066.BAbS19_II07120 568815.BMI_II466 gi|189022912|ref|YP_001932653.1| gi|340792200|ref|YP_004757664.1| gi|256015251|ref|YP_003105260.1| NYSGRC-SEC-62317663 gi|62317663|ref|YP_223516.1| gi|83269646|ref|YP_418937.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]