SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|62317791|ref|YP_223644.1| from Brucella abortus bv. 1 str. 9-941

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|62317791|ref|YP_223644.1|
Domain Number 1 Region: 39-287
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.09e-41
Family Phosphate binding protein-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|62317791|ref|YP_223644.1|
Sequence length 346
Comment ABC transporter substrate-binding protein [Brucella abortus bv. 1 str. 9-941]
Sequence
MTTTRRDILLGAAAFGLASIATRLPAYAQDASAAPEKPELMFGVGGKPLFYYLPLTIAER
KGFFEEEGIKATINDFGGGAKSLQALIGGSVDVVTGAYEHTIRMQNRGQDIKAVCELGRF
PGICIGVRKDLAGDIKTIADLKGQNVGVTAPGSSTSLLLQYALIKNGLSPDAASIIGIGG
GASAVAAIKKGEIAALVHLDPVITRLEVDGDITLLLDTRTEEGTRQLFDGTNPAATVYVQ
QSFIDANPVTTQRVVNAFVKSLKWIHNASADEVADTVPEEYLLGDRALYKTGFEKSRAMY
SQKGLIAEDGFKSLFEMLKTLDPELAGANITFAQTFDPRFVEAARA
Download sequence
Identical sequences A0A0F6AVF7 A0A0M1WI70 A0A1Z1ZQ88 A0A2K4NQE2 A9WXY5 C9V6J0 D0RDD1 D7H4W7 Q2YJX1 Q577A1
gi|62317791|ref|YP_223644.1| gi|560151223|ref|YP_008844016.1| gi|189023044|ref|YP_001932785.1| 262698.BruAb2_0896 359391.BAB2_0919 430066.BAbS19_II08480 470137.BSUIS_B0290 gi|560148831|ref|YP_008841626.1| WP_002966299.1.100018 WP_002966299.1.100204 WP_002966299.1.100443 WP_002966299.1.100628 WP_002966299.1.100807 WP_002966299.1.101247 WP_002966299.1.101411 WP_002966299.1.101965 WP_002966299.1.102026 WP_002966299.1.102082 WP_002966299.1.10322 WP_002966299.1.1055 WP_002966299.1.10630 WP_002966299.1.10844 WP_002966299.1.10866 WP_002966299.1.10893 WP_002966299.1.11066 WP_002966299.1.1158 WP_002966299.1.11620 WP_002966299.1.11769 WP_002966299.1.11859 WP_002966299.1.11933 WP_002966299.1.12041 WP_002966299.1.12241 WP_002966299.1.12704 WP_002966299.1.12981 WP_002966299.1.13460 WP_002966299.1.13576 WP_002966299.1.13826 WP_002966299.1.14542 WP_002966299.1.14633 WP_002966299.1.15077 WP_002966299.1.16733 WP_002966299.1.16975 WP_002966299.1.17378 WP_002966299.1.17733 WP_002966299.1.18034 WP_002966299.1.18494 WP_002966299.1.18635 WP_002966299.1.19483 WP_002966299.1.19508 WP_002966299.1.19641 WP_002966299.1.20012 WP_002966299.1.20317 WP_002966299.1.2214 WP_002966299.1.22142 WP_002966299.1.22583 WP_002966299.1.2337 WP_002966299.1.23458 WP_002966299.1.24196 WP_002966299.1.24428 WP_002966299.1.24496 WP_002966299.1.24607 WP_002966299.1.24655 WP_002966299.1.24726 WP_002966299.1.24895 WP_002966299.1.24923 WP_002966299.1.24971 WP_002966299.1.25101 WP_002966299.1.25135 WP_002966299.1.25382 WP_002966299.1.25450 WP_002966299.1.25729 WP_002966299.1.26599 WP_002966299.1.2778 WP_002966299.1.27794 WP_002966299.1.2839 WP_002966299.1.2874 WP_002966299.1.2877 WP_002966299.1.28889 WP_002966299.1.29765 WP_002966299.1.29997 WP_002966299.1.31094 WP_002966299.1.31106 WP_002966299.1.31239 WP_002966299.1.31635 WP_002966299.1.31644 WP_002966299.1.31680 WP_002966299.1.32337 WP_002966299.1.32492 WP_002966299.1.32779 WP_002966299.1.33032 WP_002966299.1.33220 WP_002966299.1.33289 WP_002966299.1.33599 WP_002966299.1.33753 WP_002966299.1.34183 WP_002966299.1.34353 WP_002966299.1.35056 WP_002966299.1.35338 WP_002966299.1.35577 WP_002966299.1.35970 WP_002966299.1.36149 WP_002966299.1.36712 WP_002966299.1.3681 WP_002966299.1.37797 WP_002966299.1.38925 WP_002966299.1.39021 WP_002966299.1.39039 WP_002966299.1.39963 WP_002966299.1.40189 WP_002966299.1.40407 WP_002966299.1.40624 WP_002966299.1.40649 WP_002966299.1.40871 WP_002966299.1.4091 WP_002966299.1.41044 WP_002966299.1.41105 WP_002966299.1.41311 WP_002966299.1.41835 WP_002966299.1.41893 WP_002966299.1.41950 WP_002966299.1.42065 WP_002966299.1.4207 WP_002966299.1.42071 WP_002966299.1.42103 WP_002966299.1.42427 WP_002966299.1.42633 WP_002966299.1.42774 WP_002966299.1.4295 WP_002966299.1.43058 WP_002966299.1.43148 WP_002966299.1.4319 WP_002966299.1.43359 WP_002966299.1.43583 WP_002966299.1.43597 WP_002966299.1.44045 WP_002966299.1.44060 WP_002966299.1.4428 WP_002966299.1.44541 WP_002966299.1.44949 WP_002966299.1.44989 WP_002966299.1.45546 WP_002966299.1.45559 WP_002966299.1.46182 WP_002966299.1.46432 WP_002966299.1.4727 WP_002966299.1.47545 WP_002966299.1.47558 WP_002966299.1.47610 WP_002966299.1.48075 WP_002966299.1.48184 WP_002966299.1.4847 WP_002966299.1.48727 WP_002966299.1.49427 WP_002966299.1.49640 WP_002966299.1.49953 WP_002966299.1.50051 WP_002966299.1.50053 WP_002966299.1.50282 WP_002966299.1.5052 WP_002966299.1.50952 WP_002966299.1.51553 WP_002966299.1.5236 WP_002966299.1.52478 WP_002966299.1.52541 WP_002966299.1.5307 WP_002966299.1.53128 WP_002966299.1.53481 WP_002966299.1.5394 WP_002966299.1.54440 WP_002966299.1.54481 WP_002966299.1.54776 WP_002966299.1.54779 WP_002966299.1.55047 WP_002966299.1.55284 WP_002966299.1.55440 WP_002966299.1.55585 WP_002966299.1.55684 WP_002966299.1.56334 WP_002966299.1.56621 WP_002966299.1.56683 WP_002966299.1.56952 WP_002966299.1.57541 WP_002966299.1.57925 WP_002966299.1.58525 WP_002966299.1.58539 WP_002966299.1.59086 WP_002966299.1.59515 WP_002966299.1.59985 WP_002966299.1.60134 WP_002966299.1.60920 WP_002966299.1.61081 WP_002966299.1.61325 WP_002966299.1.61536 WP_002966299.1.61811 WP_002966299.1.61961 WP_002966299.1.61997 WP_002966299.1.62872 WP_002966299.1.63628 WP_002966299.1.63730 WP_002966299.1.64013 WP_002966299.1.64124 WP_002966299.1.6440 WP_002966299.1.64585 WP_002966299.1.64853 WP_002966299.1.64905 WP_002966299.1.65131 WP_002966299.1.65454 WP_002966299.1.65501 WP_002966299.1.6555 WP_002966299.1.65597 WP_002966299.1.65625 WP_002966299.1.66078 WP_002966299.1.66260 WP_002966299.1.66268 WP_002966299.1.66340 WP_002966299.1.66407 WP_002966299.1.66647 WP_002966299.1.66810 WP_002966299.1.66855 WP_002966299.1.67107 WP_002966299.1.67402 WP_002966299.1.67893 WP_002966299.1.67996 WP_002966299.1.67997 WP_002966299.1.68913 WP_002966299.1.69451 WP_002966299.1.69829 WP_002966299.1.69997 WP_002966299.1.70160 WP_002966299.1.70322 WP_002966299.1.70570 WP_002966299.1.71194 WP_002966299.1.71228 WP_002966299.1.71689 WP_002966299.1.71846 WP_002966299.1.7206 WP_002966299.1.72189 WP_002966299.1.72439 WP_002966299.1.72533 WP_002966299.1.72916 WP_002966299.1.73628 WP_002966299.1.73739 WP_002966299.1.74005 WP_002966299.1.74236 WP_002966299.1.75128 WP_002966299.1.75434 WP_002966299.1.75458 WP_002966299.1.75563 WP_002966299.1.75766 WP_002966299.1.76350 WP_002966299.1.76433 WP_002966299.1.7667 WP_002966299.1.76877 WP_002966299.1.77165 WP_002966299.1.77281 WP_002966299.1.77321 WP_002966299.1.77683 WP_002966299.1.77685 WP_002966299.1.77899 WP_002966299.1.78109 WP_002966299.1.78590 WP_002966299.1.78821 WP_002966299.1.79327 WP_002966299.1.7984 WP_002966299.1.79963 WP_002966299.1.80059 WP_002966299.1.80167 WP_002966299.1.80266 WP_002966299.1.80476 WP_002966299.1.80697 WP_002966299.1.81027 WP_002966299.1.81276 WP_002966299.1.81377 WP_002966299.1.81617 WP_002966299.1.81674 WP_002966299.1.81822 WP_002966299.1.82113 WP_002966299.1.82205 WP_002966299.1.8224 WP_002966299.1.82390 WP_002966299.1.82448 WP_002966299.1.82595 WP_002966299.1.82753 WP_002966299.1.8278 WP_002966299.1.82834 WP_002966299.1.82990 WP_002966299.1.8307 WP_002966299.1.83161 WP_002966299.1.84207 WP_002966299.1.84512 WP_002966299.1.84601 WP_002966299.1.84764 WP_002966299.1.85322 WP_002966299.1.85684 WP_002966299.1.85753 WP_002966299.1.85769 WP_002966299.1.8657 WP_002966299.1.86832 WP_002966299.1.86901 WP_002966299.1.86923 WP_002966299.1.87522 WP_002966299.1.87603 WP_002966299.1.87867 WP_002966299.1.8788 WP_002966299.1.87893 WP_002966299.1.88424 WP_002966299.1.88658 WP_002966299.1.8878 WP_002966299.1.88867 WP_002966299.1.89113 WP_002966299.1.90027 WP_002966299.1.90420 WP_002966299.1.90689 WP_002966299.1.9096 WP_002966299.1.91081 WP_002966299.1.91123 WP_002966299.1.91338 WP_002966299.1.91710 WP_002966299.1.91768 WP_002966299.1.92383 WP_002966299.1.92518 WP_002966299.1.93454 WP_002966299.1.93795 WP_002966299.1.94126 WP_002966299.1.94555 WP_002966299.1.94770 WP_002966299.1.94775 WP_002966299.1.95148 WP_002966299.1.95178 WP_002966299.1.95770 WP_002966299.1.96661 WP_002966299.1.97240 WP_002966299.1.97320 WP_002966299.1.97331 WP_002966299.1.97511 WP_002966299.1.97741 WP_002966299.1.97860 WP_002966299.1.98076 WP_002966299.1.98455 WP_002966299.1.98704 WP_002966299.1.98764 WP_002966299.1.99221 WP_002966299.1.99373 WP_002966299.1.99421 gi|83269772|ref|YP_419063.1| gi|163844468|ref|YP_001622123.1| gi|376271452|ref|YP_005114497.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]